InnateDB InnateDB The kinase IKKα inhibits activation of the transcription factor NF-κB by phosphorylating the regulatory molecule TAX1BP1. The kinase IKKα inhibits activation of the transcription factor NF-κB by phosphorylating the regulatory molecule TAX1BP1. Nat. Immunol. (1529-2908) 2011 imex curation Shembade N., Pujari R., Harhaj N.S., Abbott D.W., Harhaj E.W. Apoptosis - Interactions involving proteins with a function related to apoptosis species of IkBa and IKKa determined through author correspondence eharhaj@med.miami.edu 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Shembade N., Pujari R., Harhaj N.S., Abbott D.W., Harhaj E.W. Apoptosis - Interactions involving proteins with a function related to apoptosis species of IkBa and IKKa determined through author correspondence eharhaj@med.miami.edu Accepted 2012-JAN-11 by MGT 14-Mar-2012: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity The kinase IKKα inhibits activation of the transcription factor NF-κB by phosphorylating the regulatory molecule TAX1BP1. The kinase IKKα inhibits activation of the transcription factor NF-κB by phosphorylating the regulatory molecule TAX1BP1. Nat. Immunol. (1529-2908) 2011 imex curation Shembade N., Pujari R., Harhaj N.S., Abbott D.W., Harhaj E.W. Apoptosis - Interactions involving proteins with a function related to apoptosis species of IkBa and IKKa determined through author correspondence eharhaj@med.miami.edu 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Shembade N., Pujari R., Harhaj N.S., Abbott D.W., Harhaj E.W. Apoptosis - Interactions involving proteins with a function related to apoptosis species of IkBa and IKKa determined through author correspondence eharhaj@med.miami.edu Accepted 2012-JAN-11 by MGT Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity The kinase IKKα inhibits activation of the transcription factor NF-κB by phosphorylating the regulatory molecule TAX1BP1. The kinase IKKα inhibits activation of the transcription factor NF-κB by phosphorylating the regulatory molecule TAX1BP1. Nat. Immunol. (1529-2908) 2011 imex curation Shembade N., Pujari R., Harhaj N.S., Abbott D.W., Harhaj E.W. Apoptosis - Interactions involving proteins with a function related to apoptosis species of IkBa and IKKa determined through author correspondence eharhaj@med.miami.edu 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Shembade N., Pujari R., Harhaj N.S., Abbott D.W., Harhaj E.W. Apoptosis - Interactions involving proteins with a function related to apoptosis IKKalpha null MEFs species of IkBa and IKKa determined through author correspondence eharhaj@med.miami.edu Accepted 2012-JAN-11 by MGT 14-Mar-2012: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity ikkb_human Inhibitor of nuclear factor kappa-B kinase subunit beta IKBKB IKKB I-kappa-B kinase 2 Nuclear factor NF-kappa-B inhibitor kinase beta Serine/threonine protein kinase IKBKB protein protein human Homo sapiens Human MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSEVDIVVSEDLNGTVKFSSSLPYPNNLNSVLAERLEKWLQLMLMWHPRQRGTDPTYGPNGCFKALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQELLQEAGLALIPDKPATQCISDGKLNEGHTLDMDLVFLFDNSKITYETQISPRPQPESVSCILQEPKRNLAFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLKAKLDFFKTSIQIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGRENEVKLLVERMMALQTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTEGDSQEMVRLLLQAIQSFEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDEKTVVRLQEKRQKELWNLLKIACSKVRGPVSGSPDSMNASRLSQPGQLMSQPSTASNSLPEPAKKSEELVAEAHNLCTLLENAIQDTVREQDQSFTALDWSWLQTEEEEHSCLEQAS DIP protein O14920 original sequence version: 89 DIP protein O14920 original sequence version: 100 DIP protein O14920 original sequence version: 121 DIP protein O14920 original sequence version: 126 DIP protein O14920 original sequence version: 136 DIP protein O14920 original sequence version: 128 DIP protein O14920-1 original sequence version: 151 DIP protein O14920 original sequence version: 142 DIP protein O14920 original sequence version: 159 DIP protein O14920 original sequence version: 93 DIP protein O14920 original sequence version: 124 DIP protein O14920-1 original sequence version: 178 DIP protein O14920 original sequence version: 85 F9CADF671AE9E14E tnap3_mouse Tumor necrosis factor alpha-induced protein 3 Putative DNA-binding protein A20 Zinc finger protein A20 Tnfaip3 Tnfip3 protein protein mouse Mus musculus Mouse MAEQLLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIYHFKTMHRYTLEMFRTCQFCPQFREIIHKALIDRSVQASLESQKKLNWCREVRKLVALKTNGDGNCLMHAACQYMWGVQDTDLVLRKALCSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRNWNDEWDNLVKMASADTPAARSGLQYNSLEEIHIFVLSNILRRPIIVISDKMLRSLESGSNFAPLKVGGIYLPLHWPAQECYRYPIVLGYDSQHFVPLVTLKDSGPELRAVPLVNRDRGRFEDLKVHFLTDPENEMKEKLLKEYLIVMEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQHEYKKWQENSDQARRAAHAQNPLEPSTPQLSLMDIKCETPNCPFFMSVNTQPLCHECSERRQKNQSKLPKLNSKLGPEGLPGVGLGSSNWSPEETAGGPHSAPPTAPSLFLFSETTAMKCRSPGCPFTLNVQHNGFCERCHARQINASHTADPGKCQACLQDVTRTFNGICSTCFKRTTAEPSSSLTSSIPASCHQRSKSDPSQLIQSLTPHSCHRTGNVSPSGCLSQAARTPGDRAGTSKCRKAGCMYFGTPENKGFCTLCFIEYRENKQSVTASEKAGSPAPRFQNNVPCLGRECGTLGSTMFEGYCQKCFIEAQNQRFHEARRTEEQLRSSQHRDMPRTTQVASRLKCARASCKNILACRSEELCMECQHLSQRVGSVAHRGEPTPEEPPKQRCRAPACDHFGNAKCNGYCNECYQFKQMYG DIP protein Q60769 original sequence version: 92 DIP protein Q60769 original sequence version: 138 32349928908B3185 rnf11_mouse RING finger protein 11 Rnf11 N4wbp2 Sid1669 NEDD4 WW domain-binding protein 2 Sid 1669 protein protein mouse Mus musculus Mouse MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPIYHPTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN EF192AB0C2D4BF87 taxb1_human Tax1-binding protein 1 TRAF6-binding protein TAX1BP1 T6BP PRO0105 protein protein human Homo sapiens Human MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGYYLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDMLVVTTKAGLLELKIEKTMKEKEELLKLIAVLEKETAQLREQVGRMERELNHEKERCDQLQAEQKGLTEVTQSLKMENEEFKKRFSDATSKAHQLEEDIVSVTHKAIEKETELDSLKDKLKKAQHEREQLECQLKTEKDEKELYKVHLKNTEIENTKLMSEVQTLKNLDGNKESVITHFKEEIGRLQLCLAEKENLQRTFLLTTSSKEDTCFLKEQLRKAEEQVQATRQEVVFLAKELSDAVNVRDRTMADLHTARLENEKVKKQLADAVAELKLNAMKKDQDKTDTLEHELRREVEDLKLRLQMAADHYKEKFKECQRLQKQINKLSDQSANNNNVFTKKTGNQQKVNDASVNTDPATSASTVDVKPSPSAAEADFDIVTKGQVCEMTKEIADKTEKYNKCKQLLQDEKAKCNKYADELAKMELKWKEQVKIAENVKLELAEVQDNYKELKRSLENPAERKMEGQNSQSPQCFKTCSEQNGYVLTLSNAQPVLQYGNPYASQETRDGADGAFYPDEIQRPPVRVPSWGLEDNVVCSQPARNFSRPDGLEDSEDSKEDENVPTAPDPPSQHLRGHGTGFCFDSSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNVLNFD DE8460DAA6712125 q86vp1-2 Tax1-binding protein 1 TXBP151-L TAX1BP1 T6BP TRAF6-binding protein PRO0105 protein protein human Homo sapiens Human MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGYYLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDMLVVTTKAGLLELKIEKTMKEKEELLKLIAVLEKETAQLREQVGRMERELNHEKERCDQLQAEQKGLTEVTQSLKMENEEFKKRFSDATSKAHQLEEDIVSVTHKAIEKETELDSLKDKLKKAQHEREQLECQLKTEKDEKELYKVHLKNTEIENTKLMSEVQTLKNLDGNKESVITHFKEEIGRLQLCLAEKENLQRTFLLTTSSKEDTCFLKEQLRKAEEQVQATRQEVVFLAKELSDAVNVRDRTMADLHTARLENEKVKKQLADAVAELKLNAMKKDQDKTDTLEHELRREVEDLKLRLQMAADHYKEKFKECQRLQKQINKLSDQSANNNNVFTKKTGNQQKVNDASVNTDPATSASTVDVKPSPSAAEADFDIVTKGQVCEMTKEIADKTEKYNKCKQLLQDEKAKCNKYADELAKMELKWKEQVKIAENVKLELAEVQDNYKELKRSLENPAERKMEDGADGAFYPDEIQRPPVRVPSWGLEDNVVCSQPARNFSRPDGLEDSEDSKEDENVPTAPDPPSQHLRGHGTGFCFDSSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNVLNFD 93EEDFF29106CE1C ripk1_mouse Receptor-interacting serine/threonine-protein kinase 1 Cell death protein RIP Receptor-interacting protein 1 Ripk1 Rinp Rip protein protein mouse Mus musculus Mouse MQPDMSLDNIKMASSDLLEKTDLDSGGFGKVSLCYHRSHGFVILKKVYTGPNRAEYNEVLLEEGKMMHRLRHSRVVKLLGIIIEEGNYSLVMEYMEKGNLMHVLKTQIDVPLSLKGRIIVEAIEGMCYLHDKGVIHKDLKPENILVDRDFHIKIADLGVASFKTWSKLTKEKDNKQKEVSSTTKKNNGGTLYYMAPEHLNDINAKPTEKSDVYSFGIVLWAIFAKKEPYENVICTEQFVICIKSGNRPNVEEILEYCPREIISLMERCWQAIPEDRPTFLGIEEEFRPFYLSHFEEYVEEDVASLKKEYPDQSPVLQRMFSLQHDCVPLPPSRSNSEQPGSLHSSQGLQMGPVEESWFSSSPEYPQDENDRSVQAKLQEEASYHAFGIFAEKQTKPQPRQNEAYNREEERKRRVSHDPFAQQRARENIKSAGARGHSDPSTTSRGIAVQQLSWPATQTVWNNGLYNQHGFGTTGTGVWYPPNLSQMYSTYKTPVPETNIPGSTPTMPYFSGPVADDLIKYTIFNSSGIQIGNHNYMDVGLNSQPPNNTCKEESTSRHQAIFDNTTSLTDEHLNPIRENLGRQWKNCARKLGFTESQIDEIDHDYERDGLKEKVYQMLQKWLMREGTKGATVGKLAQALHQCCRIDLLNHLIRASQS DIP protein Q60855 original sequence version: 85 DIP protein Q60855 original sequence version: 109 DIP protein Q60855 original sequence version: 152 DIP protein Q60855 original sequence version: 130 DIP protein Q60855 original sequence version: 84 DIP protein Q60855 original sequence version: 123 DIP protein Q60855 original sequence version: 158 ABB350B523879933 ikba_human NF-kappa-B inhibitor alpha NFKBIA IKBA MAD3 NFKBI I-kappa-B-alpha Major histocompatibility complex enhancer-binding protein MAD3 protein protein human Homo sapiens Human MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTEDELPYDDCVFGGQRLTL DIP protein P25963 original sequence version: 160 DIP protein P25963 original sequence version: 157 DIP protein P25963 original sequence version: 145 DIP protein P25963 original sequence version: 170 DIP protein P25963 original sequence version: 122 DIP protein P25963 original sequence version: 128 DIP protein P25963 original sequence version: 78 DIP protein P25963 original sequence version: 121 DIP protein P25963 original sequence version: 124 088B313226786395 birc2_mouse Baculoviral IAP repeat-containing protein 2 Inhibitor of apoptosis protein 2 Birc2 Cellular inhibitor of apoptosis 1 RING-type E3 ubiquitin transferase BIRC2 protein protein mouse Mus musculus Mouse MDKTVSQRLGQGTLHQKLKRIMEKSTILSNWTKESEEKMKFDFSCELYRMSTYSAFPRGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKQGDSPVEKHRQFYPSCSFVQTLLSASLQSPSKNMSPVKSRFAHSSPLERGGIHSNLCSSPLNSRAVEDFSSRMDPCSYAMSTEEARFLTYSMWPLSFLSPAELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPHCPFLENTSETQRFSISNLSMQTHSARLRTFLYWPPSVPVQPEQLASAGFYYVDRNDDVKCFCCDGGLRCWEPGDDPWIEHAKWFPRCEFLIRMKGQEFVDEIQARYPHLLEQLLSTSDTPGEENADPTETVVHFGPGESSEDVVMMSTPVVKAALEMGFSRSLVRQTVQRQILATGENYRTVNDIVSVLLNAEDERREEEKERQTEEMASGDLSLIRKNRMALFQQLTHVLPILDNLLEASVITKQEHDIIRQKTQIPLQARELIDTVLVKGNAAANIFKNSLKEIDSTLYENLFVEKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDREVSIVFIPCGHLVVCQECAPSLRKCPICRGTIKGTVRTFLS E08969D93C6C610D traf2_mouse TNF receptor-associated factor 2 Traf2 E3 ubiquitin-protein ligase TRAF2 RING-type E3 ubiquitin transferase TRAF2 protein protein mouse Mus musculus Mouse MAAASVTSPGSLELLQPGFSKTLLGTRLEAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHYEVCPKFPLTCDGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL DIP protein P39429 original sequence version: 90 DIP protein P39429 original sequence version: 130 DIP protein P39429 original sequence version: 135 DIP protein P39429 original sequence version: 166 043B391180365F10 taxb1_mouse Tax1-binding protein 1 homolog Tax1bp1 protein protein mouse Mus musculus Mouse MTSFQEVQLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHSKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGYYLPNDDGEFYQFCYVTHKGEIRGASTPFQFRAASPVEELLTMEDEGNSDMLVVTTKAGLLELKIEKTLKEKEELLKLIAVLEKETAQLREQVGRMERELSQEKGRCEQLQAEQKGLLEVSQSLRVENEEFMKRYSDATAKVQQLEEDIVSVTHKAIEKETDLDSLKDKLRKAQHEREQLECQLQTEKDEKELYKVHLKNTEIENTKLVSEIQTLKNLDGNKESMITHFKEEISKLQSCLADKENLYRALLLTTSNKEDTLFLKEQLRKAEEQVQATRQELIFLTKELSDAVNVRDKTMADLHTARLENERVKKQLADTLAELQLHAVKKDQEKTDTLEHELRREVEDLKLRLQMAADHYREKFKECQRLQKQINKLSDQAASTNSVFTKKMGSQQKVNDASINTDPAASTSASAVDVKPAASCAETGFDMSTKDHVCEMTKEIAEKIEKYNKCKQLLQDEKTKCNKYAEELAKMELKWKEQVKIAENVKLELAEVEDNYKVQLAEKEKEINGLASYLENLSREKELTKSLEDQKGRKLEGQSPQQVSRCLNTCSEQNGLLPPLSSAQPVLQYGNPYSAQETRDGADGAFYPDEIQRPPVRVPSWEDNVVCSQPARNLSRPDGLEDPEDSREDENVPIPPDPANQHLRSHGAGFCFDSSFDVHKKCPLCELMFPPNYDQTKFEEHVESHWKVCPMCSEQFPPDYDQQGFERHVQTHFDQNVLNFD 828A1FC7D61A06B7 itch_mouse E3 ubiquitin-protein ligase Itchy Itch HECT-type E3 ubiquitin transferase Itchy homolog protein protein mouse Mus musculus Mouse MSDSGPQLDSMGSLTMKSQLQITVISAKLKENKKNWFGPSPYVEVTVDGQSKKTEKCNNTNSPKWKQPLTVIVTPTSKLCFRVWSHQTLKSDVLLGTAGLDIYETLKSNNMKLEEVVMTLQLVGDKEPTETMGDLSVCLDGLQVEAEVVTNGETSCSESTTQNDDGCRTRDDTRVSTNGSEDPEVAASGENKRANGNNSPSLSNGGFKPSRPPRPSRPPPPTPRRPASVNGSPSTNSDSDGSSTGSLPPTNTNVNTSTSEGATSGLIIPLTISGGSGPRPLNTVSQAPLPPGWEQRVDQHGRVYYVDHVEKRTTWDRPEPLPPGWERRVDNMGRIYYVDHFTRTTTWQRPTLESVRNYEQWQLQRSQLQGAMQQFNQRFIYGNQDLFATSQNKEFDPLGPLPPGWEKRTDSNGRVYFVNHNTRITQWEDPRSQGQLNEKPLPEGWEMRFTVDGIPYFVDHNRRATTYIDPRTGKSALDNGPQIAYVRDFKAKVQYFRFWCQQLAMPQHIKITVTRKTLFEDSFQQIMSFSPQDLRRRLWVIFPGEEGLDYGGVAREWFFLLSHEVLNPMYCLFEYAGKDNYCLQINPASYINPDHLKYFRFIGRFIAMALFHGKFIDTGFSLPFYKRILNKPVGLKDLESIDPEFYNSLIWVKENNIEECGLEMYFSVDKEILGEIKSHDLKPNGGNILVTEENKEEYIRMVAEWRLSRGVEEQTQAFFEGFNEILPQQYLQYFDAKELEVLLCGMQEIDLNDWQRHAIYRHYTRTSKQIMWFWQFVKEIDNEKRMRLLQFVTGTCRLPVGGFADLMGSNGPQKFCIEKVGKENWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFGQE DIP protein Q8C863 original sequence version: 44 905FDBE00A1EA7EA traf6_mouse TNF receptor-associated factor 6 RING-type E3 ubiquitin transferase TRAF6 Traf6 E3 ubiquitin-protein ligase TRAF6 protein protein mouse Mus musculus Mouse MSLLNCENSCGSSQSSSDCCAAMAASCSAAVKDDSVSGSASTGNLSSSFMEEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILSLTVKCPNKGCLQKMELRHLEDHQVHCEFALVNCPQCQRPFQKCQVNTHIIEDCPRRQVSCVNCAVSMAYEEKEIHDQSCPLANIICEYCGTILIREQMPNHYDLDCPTAPIPCTFSVFGCHEKMQRNHLARHLQENTQLHMRLLAQAVHNVNLALRPCDAASPSRGCRPEDPNYEETIKQLESRLVRQDHQIRELTAKMETQSMYVGELKRTIRTLEDKVAEMEAQQCNGIYIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEALIRQNHEEVMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQGTFIKDDTLLVRCEVSTRFDMGGLRKEGFQPRSTDAGV DIP protein P70196 original sequence version: 139 DIP protein P70196 original sequence version: 128 DIP protein P70196 original sequence version: 144 DIP protein P70196 original sequence version: 83 DIP protein P70196 original sequence version: 98 DIP protein P70196 original sequence version: 104 DIP protein P70196 original sequence version: 112 DIP protein P70196 original sequence version: 163 F8389250425E4E2D ube2n_mouse Ubiquitin-conjugating enzyme E2 N Ubiquitin-protein ligase N Ubiquitin carrier protein N Ubc13 Bendless-like ubiquitin-conjugating enzyme E2 ubiquitin-conjugating enzyme N Ube2n Blu protein protein mouse Mus musculus Mouse MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI FACD84D883D77407 ikka_mouse Inhibitor of nuclear factor kappa-B kinase subunit alpha I-kappa-B kinase 1 Conserved helix-loop-helix ubiquitous kinase Nuclear factor NF-kappa-B inhibitor kinase alpha Chuk Ikka protein protein mouse Mus musculus Mouse MERPPGLRPGAGGPWEMRERLGTGGFGNVSLYQHRELDLKIAIKSCRLELSSKNRERWCHEIQIMKKLDHANVVKACDVPEELNFLINDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKTIHKIIDLGYAKDVDQGSLCTSFVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPKCIFACEEMTGEVRFSSHLPQPNSLCSLIVEPMESWLQLMLNWDPQQRGGPIDLTLKQPRCFALMDHILNLKIVHILNMTSAKIISFLLPCDESLHSLQSRIERETGINTGSQELLSETGISLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPIIQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKLEFFRKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYSEVGVIGYLEDQIMSLHTEIMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPPDHLYSDSTEMVKIIVHTVQSQDRVLKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQSSARSLVGSSLEGTVTPPVSAWLPPTLADREHPLTCVVTPQDGETLAQMIEENLNCLGHLSTIIREANEDQSSSLMSLDWSWLAE DIP protein Q60680 original sequence version: 82 DIP protein Q60680 original sequence version: 86 DIP protein Q60680 original sequence version: 113 DIP protein Q60680 original sequence version: 126 DIP protein Q60680 original sequence version: 158 3FEF5582AFF92233 ub2r1_mouse Ubiquitin-conjugating enzyme E2 R1 Cdc34 Ubch3 Ube2r1 Ubiquitin-protein ligase R1 Ubiquitin-conjugating enzyme E2-32 kDa complementing Ubiquitin-conjugating enzyme E2-CDC34 (E3-independent) E2 ubiquitin-conjugating enzyme R1 E2 ubiquitin-conjugating enzyme R1 protein protein mouse Mus musculus Mouse MARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEADSCFGDEEDDSGTEES 3259FA0CD407E1E3 ikka_human Inhibitor of nuclear factor kappa-B kinase subunit alpha CHUK IKKA TCF16 I-kappa-B kinase 1 Conserved helix-loop-helix ubiquitous kinase Nuclear factor NF-kappa-B inhibitor kinase alpha Transcription factor 16 protein protein human Homo sapiens Human MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCHEIQIMKKLNHANVVKACDVPEELNILIHDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIIHKIIDLGYAKDVDQGSLCTSFVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPKCIFACEEMSGEVRFSSHLPQPNSLCSLVVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRCFVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGISLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPIIQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKLEFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHAEIMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRVLKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMNLDWSWLTE DIP protein O15111 original sequence version: 91 DIP protein O15111 original sequence version: 123 DIP protein O15111 original sequence version: 133 DIP protein O15111 original sequence version: 118 DIP protein O15111 original sequence version: 125 DIP protein O15111 original sequence version: 96 4EA55C6FFC66FA16 ikka-4 2 19 putative self putative self putative self putative self region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. phosphorylation phosphorylation reaction phosphorylation true Fig 1F chuk-tax1bp1 2 19 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. 7 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation Fig. 1F ikkb 2 4 putative self putative self putative self putative self region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. phosphorylation phosphorylation reaction phosphorylation true Fig. 1F chuk-nfkbia-9 2 10 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. phosphorylation phosphorylation reaction phosphorylation Fig. 1F ikbkb-nfkbia-8 2 10 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 enzyme enzyme neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. phosphorylation phosphorylation reaction phosphorylation Fig. 1F tax1bp1-chuk 3 19 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O15111:p.Lys44Met mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K M Wed May 02 16:08:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys44met' Tue Jun 30 19:21:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys44Met' 7 unspecified role unspecified role bait bait physical association physical association Tax1bp1 null MEF complemented with human TAX1BP1 TNF or IL1 Fig. 1G chuk-tax1bp1-1 3 17 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q86VP1-2:p.Ser624Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A Thu Jul 07 12:06:56 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was ser624ala Wed May 02 15:37:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser624ala' Tue Jun 30 17:31:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser624Ala' physical association physical association Fig. S4 TNF traf2-birc2-2 1 5 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q86VP1-2:p.[Ser593Ala;Ser624Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A Wed May 02 18:32:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser593ala,ser624ala' Tue Jun 30 18:35:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser593Ala;Ser624Ala]' 16 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey association association Fig. 4A TNF Tax1bp1-deficient MEFs and MEFs transfected with TAX1BP1(S593A,S624A) failed to interact with TRAF2 or TRAF6 and were also impaired in the recruitment of Itch and A20 to the TRAF proteins. Transfection of wild-type (phosphorylated) TAX1BP1 reduced the interactions between Ubc13, RIP1 and cIAP1 with TRAF-2. traf6-cdc34 1 8 unspecified role unspecified role prey prey Q86VP1-2:p.[Ser593Ala;Ser624Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A Wed May 02 20:09:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser593ala,ser624ala' Tue Jun 30 16:16:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser593Ala;Ser624Ala]' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey association association Fig. 4B IL-1 Tax1bp1-deficient MEFs and MEFs transfected with TAX1BP1(S593A,S624A) failed to interact with TRAF2 or TRAF6 and were also impaired in the recruitment of Itch, RNF11 and A20 to the TRAF proteins. Transfection of wild-type (phosphorylated) TAX1BP1 reduced the interactions between Ubc13 and Cdc34 with TRAF-6. rnf11-itch-6 1 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey Q86VP1-2:p.Ser593Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:34:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser593ala' Tue Jun 30 18:22:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser593Ala' Q86VP1-2:p.[Ser593Ala;Ser624Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A Wed May 02 14:47:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser593ala,ser624ala' Tue Jun 30 16:09:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser593Ala;Ser624Ala]' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q86VP1-2:p.Ser624Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A Thu Jul 07 12:16:47 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was ser624ala Wed May 02 14:36:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser624ala' Tue Jun 30 18:50:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser624Ala' 14 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association Fig. 5C TNF (15min) rnf11-itch-7 1 5 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey Q86VP1-2:p.Ser624Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A Thu Jul 07 12:17:44 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was ser624ala Wed May 02 17:16:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser624ala' Tue Jun 30 20:10:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser624Ala' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q86VP1-2:p.Ser593Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A Wed May 02 18:12:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser593ala' Tue Jun 30 17:16:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser593Ala' Q86VP1-2:p.[Ser593Ala;Ser624Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:26:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser593ala,ser624ala' Tue Jun 30 20:11:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser593Ala;Ser624Ala]' 14 unspecified role unspecified role prey prey association association Fig. 5D IL-1 (15min) ripk1-tnfaip3 1 5 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association Fig. 6A TNF interaction not detected in Ikka null MEFs. tax1bp1-itch 1 14 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association Fig. 6B, 6C, 6D TNF, IL-1 interaction not detected in Ikka null MEFs. tnfaip3-ripk1 1 13 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association IL-1 Fig. 6D tax1bp1-chuk-1 1 9 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association Fig. 6C TNF tax1bp1-chuk-2 1 17 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association 8c Tax TNF and IL-1.