MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it A single amino acid change in the transmembrane domain of the VirB8 protein affects dimerization, interaction with VirB10 and Brucella suis virulence. A single amino acid change in the transmembrane domain of the VirB8 protein affects dimerization, interaction with VirB10 and Brucella suis virulence. FEBS Lett. (0014-5793) 2011 imex curation Andrieux L., Bourg G., Pirone A., O'Callaghan D., Patey G. suggested by lperfetto Only protein-protein interactions ecoli Escherichia coli (strain K12) 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Andrieux L., Bourg G., Pirone A., O'Callaghan D., Patey G. suggested by lperfetto FEBS Lett. (0014-5793) 2011 Only protein-protein interactions imex curation virba_agrfc Protein virB10 virB10 AGR_pTi_13 Atu6176 protein protein agrt5 Agrobacterium tumefaciens (strain C58 / ATCC 33970) Agrobacterium tumefaciens (strain C58) MNDDNQQSAHDVDASGSLVSDTHHRRLSGAQKLIVGGVVLALSLSLIWLGGREKKENGDAPPSTMIATNTKPFHPAPIDVTLDPPAAQEAVQPTAPPPARSEPERHEPRPEETPIFAYTSGDQGTSKRVQQGETDRRREGNGEDSPLPKVEVSAENDLSIRMKPTELQPTRATLLPHPDFMVTEGTIIPCILQTAIDTSLAGYVKCVLPWDVRGTTNNVVLLDRGTTVVGEIQRGLQQGDARVFVLWDRAETPDHAMISLASPSADELGRSGLPGTVDNHFWQRFSGAMLLSVVQGAFQAASTYAGSSGGGTSFNSVQNNGEQTADTALKATINIPPTLKKNQGDTVSIFVARDLDFSGIYQLRMAGRAARGRDRRP F91BB4CFCC3FE29D virba_brusu Type IV secretion system protein virB10 BS1330_II0060 virB10 BRA0060 protein protein brusu brusu MTQENIPVQPGTLDGERGLPTVNENGSGRTRKVLLFLFVVGFIVVLLLLLVFHMRGNAENNHHSDKTMVQTSTVPMRTFKLPPPPPPPPPAPPEPPAPPPAPAMPIAEPAAAALSLPPLPDDTPAKDDVLDKSASALMVVTKSSGDTNAQTAGDTVVQTTNARIQALLDSQKNTKQDAGSLGTLLHGTQTDARMASLLRNRDFLLAKGSIINCALQTRLDSTVPGMAACVVTRNMYSDNGKVLLIERGSTISGEYDANVKQGMARIYVLWTRVKTPNGVVIDLDSPGADPLGGAGLPGYIDSHFWKRFGGALMLSTIETLGRYATQKVGGGGSNQINLNTGGGESTSNLASTALKDTINIPPTLYKNQGEEIGIYIARDLDFSSVYDVKPK DIP protein Q9RPX5 original sequence version: 60 mint A7720A28B30194B6 virb8_agrfc Protein virB8 virB8 AGR_pTi_11 Atu6174 protein protein agrt5 Agrobacterium tumefaciens (strain C58 / ATCC 33970) Agrobacterium tumefaciens (strain C58) MKGSEYALLVARETLAEHYKEVEAFQTARAKSARRLSKVIAAVATIAVLGNVAQAFTIATMVPLIRLVPVYLWIRPDGTVDSEVSVSRLPATQEEAVVNASLWEYVRLRESYDADTAQYAYDLVSNFSAPMVRQNYQQFFNYPNPTSPQVILGKHGRLEVEHIASNDVTPGVQQIRYKRTLIVDGKMPMASTWTATVRYEKVTSLPGRLRLTNPGGLVVTSYQTSEDTVSNAGHSEP DIP protein P17798 original sequence version: 102 71FEE1084B9597E9 q91ur4_9bact traJ protein protein uncultured bacterium uncultured bacterium MFRRKKAAGDEVTPPNAVQAKDPFEQENNWEASRTQAIEKSEQRAWYVAYGAVGVAVLSWLAIVLMMPLKETIPYVIRVDNTTGVPDIVTALNSKGVGYEEVMDKYWLAQFVRARETYDWYTLQKDYNTVGLLASPNVGKDYAALFEGPEALDKKFGKSVRATVEIVSVVPNGRGVGTVRFIKTTKRTDDDGPGTVTKWVATVAYEYRNPSLISESQRLVNPFGFQVLSYRQDPEMVGGGQ mint 01232F2ACE262D74 virb8_brusu Type IV secretion system protein virB8 BRA0062 BS1330_II0062 virB8 protein protein brusu brusu MFGRKQSPQKSVKNGQGNAPSVYDEALNWEAAHVRLVEKSERRAWKIAGAFGTITVLLGIGIAGMLPLKQHVPYLVRVNAQTGAPDILTSLDEKSVSYDTVMDKYWLSQYVIARETYDWYTLQKDYETVGMLSSPSEGQSYASQFQGDKALDKQYGSNVRTSVTIVSIVPNGKGIGTVRFAKTTKRTNETGDGETTHWIATIGYQYVNPSLMSESARLTNPLGFNVTSYRVDPEMGVVQ DIP protein Q7CEG3 original sequence version: 74 68F44CBCF7018023 virb8-virb8-5 1 VirB8 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q7CEG3:p.Gly59Trp mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G W Tue Jul 12 10:16:54 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 14:26:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly59trp' Tue Jun 30 18:57:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly59Trp' fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined VirB8 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q7CEG3:p.Gly59Trp mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G W Tue Jul 12 10:16:56 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 19:46:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly59trp' Tue Jun 30 19:43:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly59Trp' fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2 mint virb8-virb8-6 1 VirB8 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q7CEG3:p.Gly49Tyr mutation increasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G Y Tue Jul 12 10:56:09 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 18:28:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly49tyr' Tue Jun 30 17:56:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly49Tyr' fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined VirB8 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q7CEG3:p.Gly49Tyr mutation increasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G Y Tue Jul 12 10:19:57 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 19:08:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly49tyr' Tue Jun 30 15:42:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly49Tyr' fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2 mint traj-traj 1 TraJ 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q91UR4:p.Trp60Gly mutation increasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W G Tue Jul 12 10:19:31 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 20:04:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp60gly' Tue Jun 30 16:41:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp60Gly' fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined TraJ 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q91UR4:p.Trp60Gly mutation increasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W G Tue Jul 12 10:19:36 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 17:36:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp60gly' Tue Jun 30 19:26:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp60Gly' fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2 mint traj-traj-1 1 TraJ 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q91UR4:p.Tyr50Gly mutation increasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y G Tue Jul 12 10:11:32 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 20:13:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr50gly' Tue Jun 30 18:34:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr50Gly' fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q91UR4:p.Trp60Gly mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W G Tue Jul 12 10:11:24 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 15:19:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp60gly' Tue Jun 30 16:24:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp60Gly' TraJ 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q91UR4:p.Tyr50Gly mutation increasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y G Tue Jul 12 10:11:32 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 17:14:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr50gly' Tue Jun 30 19:15:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr50Gly' Q91UR4:p.Trp60Gly mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W G Tue Jul 12 10:52:01 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 19:12:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp60gly' Tue Jun 30 17:18:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp60Gly' fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2 mint virb10-virb8-1 1 VirB10 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined VirB8 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q7CEG3:p.Gly59Trp mutation decreasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G W Tue Jul 12 10:53:38 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 19:07:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly59trp' Tue Jun 30 20:10:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly59Trp' fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f5 mint virb8-virb10-2 1 VirB10 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined VirB8 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q7CEG3:p.Gly59Trp mutation decreasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G W Tue Jul 12 10:53:25 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 15:22:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly59trp' Tue Jun 30 15:35:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly59Trp' fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f5 mint virb10-virb10-2 1 VirB10 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined VirB10 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f5 mint virb10-virb10-3 1 AtVirB10 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined AtVirB10 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f6 mint virb8-virb10-3 1 AtVirB10 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined AtVirB8 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P17798:p.Ala55Trp mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A W Tue Jul 12 10:06:32 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 19:51:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala55trp' Tue Jun 30 18:23:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala55Trp' physical association physical association f6 mint virb8-virb8-7 1 AtVirB8 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell P17798:p.Ala55Trp mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A W Tue Jul 12 10:49:29 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 18:05:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala55trp' Tue Jun 30 18:22:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala55Trp' fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined AtVirB8 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P17798:p.Ala55Trp mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A W Tue Jul 12 10:06:29 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 16:11:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala55trp' Tue Jun 30 17:39:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala55Trp' fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f6 mint virb10-virb8-2 1 AtVirB10 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined AtVirB8 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P17798:p.Ala55Trp mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A W Tue Jul 12 10:07:02 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 16:19:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala55trp' Tue Jun 30 17:06:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala55Trp' physical association physical association f6 mint