IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The auxin signalling network translates dynamic input into robust patterning at the shoot apex The auxin signalling network translates dynamic input into robust patterning at the shoot apex Mol. Syst. Biol. 2011 imex curation Vernoux T., Brunoud G., Farcot E., Morin V., Van den Daele H., Legrand J., Oliva M., Das P., Larrieu A., Wells D., Guedon Y., Armitage L., Picard F., Guyomarc'h S., Cellier C., Parry G., Koumproglou R., Doonan J.H., Estelle M., Godin C., Kepinski S., Bennett M., De Veylder L., Traas J. 2011-5-21: Teva Vernoux; Plant Reproduction and Development Laboratory, Lyon, France. Interactions were scored as beign positive based on the X-Gal and His results. The positive interaction are positive for at least one X-gal and one His test. teva.vernoux@ens-lyon.fr orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Vernoux T., Brunoud G., Farcot E., Morin V., Van den Daele H., Legrand J., Oliva M., Das P., Larrieu A., Wells D., Guedon Y., Armitage L., Picard F., Guyomarc'h S., Cellier C., Parry G., Koumproglou R., Doonan J.H., Estelle M., Godin C., Kepinski S., Bennett M., De Veylder L., Traas J. 2011-5-21: Teva Vernoux; Plant Reproduction and Development Laboratory, Lyon, France. Interactions were scored as beign positive based on the X-Gal and His results. The positive interaction are positive for at least one X-gal and one His test. teva.vernoux@ens-lyon.fr Accepted 2011-JUL-19 by ORCHARD Mol. Syst. Biol. 2011 orchard Only protein-protein interactions imex curation The auxin signalling network translates dynamic input into robust patterning at the shoot apex The auxin signalling network translates dynamic input into robust patterning at the shoot apex Mol. Syst. Biol. 2011 imex curation Vernoux T., Brunoud G., Farcot E., Morin V., Van den Daele H., Legrand J., Oliva M., Das P., Larrieu A., Wells D., Guedon Y., Armitage L., Picard F., Guyomarc'h S., Cellier C., Parry G., Koumproglou R., Doonan J.H., Estelle M., Godin C., Kepinski S., Bennett M., De Veylder L., Traas J. 2011-5-21: Teva Vernoux; Plant Reproduction and Development Laboratory, Lyon, France. Interactions were scored as beign positive based on the X-Gal and His results. The positive interaction are positive for at least one X-gal and one His test. teva.vernoux@ens-lyon.fr orchard Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vernoux T., Brunoud G., Farcot E., Morin V., Van den Daele H., Legrand J., Oliva M., Das P., Larrieu A., Wells D., Guedon Y., Armitage L., Picard F., Guyomarc'h S., Cellier C., Parry G., Koumproglou R., Doonan J.H., Estelle M., Godin C., Kepinski S., Bennett M., De Veylder L., Traas J. 2011-5-21: Teva Vernoux; Plant Reproduction and Development Laboratory, Lyon, France. Interactions were scored as beign positive based on the X-Gal and His results. The positive interaction are positive for at least one X-gal and one His test. teva.vernoux@ens-lyon.fr Accepted 2011-JUL-19 by ORCHARD Mol. Syst. Biol. 2011 orchard Only protein-protein interactions imex curation The auxin signalling network translates dynamic input into robust patterning at the shoot apex The auxin signalling network translates dynamic input into robust patterning at the shoot apex Mol. Syst. Biol. 2011 imex curation Vernoux T., Brunoud G., Farcot E., Morin V., Van den Daele H., Legrand J., Oliva M., Das P., Larrieu A., Wells D., Guedon Y., Armitage L., Picard F., Guyomarc'h S., Cellier C., Parry G., Koumproglou R., Doonan J.H., Estelle M., Godin C., Kepinski S., Bennett M., De Veylder L., Traas J. 2011-5-21: Teva Vernoux; Plant Reproduction and Development Laboratory, Lyon, France. Interactions were scored as beign positive based on the X-Gal and His results. The positive interaction are positive for at least one X-gal and one His test. teva.vernoux@ens-lyon.fr orchard Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Vernoux T., Brunoud G., Farcot E., Morin V., Van den Daele H., Legrand J., Oliva M., Das P., Larrieu A., Wells D., Guedon Y., Armitage L., Picard F., Guyomarc'h S., Cellier C., Parry G., Koumproglou R., Doonan J.H., Estelle M., Godin C., Kepinski S., Bennett M., De Veylder L., Traas J. 2011-5-21: Teva Vernoux; Plant Reproduction and Development Laboratory, Lyon, France. Interactions were scored as beign positive based on the X-Gal and His results. The positive interaction are positive for at least one X-gal and one His test. teva.vernoux@ens-lyon.fr Accepted 2011-JUL-19 by ORCHARD Mol. Syst. Biol. 2011 orchard Only protein-protein interactions imex curation iaa5_arath Auxin-responsive protein IAA5 IAA5 AUX2-27 Auxin-induced protein AUX2-27 Indoleacetic acid-induced protein 5 T16N11.9 At1g15580 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MANESNNLGLEITELRLGLPGDIVVSGESISGKKRASPEVEIDLKCEPAKKSQVVGWPPVCSYRRKNSLERTKSSYVKVSVDGAAFLRKIDLEMYKCYQDLASALQILFGCYINFDDTLKESECVPIYEDKDGDWMLAGDVPWEMFLGSCKRLRIMKRSCNRG 4B55212FADF344B2 iaa13_arath Auxin-responsive protein IAA13 Indoleacetic acid-induced protein 13 IAA13 F4P9.8 At2g33310 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MITELEMGKGESELELGLGLSLGGGTAAKIGKSGGGGAWGERGRLLTAKDFPSVGSKRAADSASHAGSSPPRSSSQVVGWPPIGSHRMNSLVNNQATKSAREEEEAGKKKVKDDEPKDVTKKVNGKVQVGFIKVNMDGVAIGRKVDLNAHSSYENLAQTLEDMFFRTNPGTVGLTSQFTKPLRLLDGSSEFVLTYEDKEGDWMLVGDVPWRMFINSVKRLRVMKTSEANGLAARNQEPNERQRKQPV 5B57E065DA786CD4 iaa31_arath Auxin-responsive protein IAA31 IAA31 Indoleacetic acid-induced protein 31 MKP6.16 At3g17600 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEVSNSCSSFSSSSVDSTKPSPSESSVNLSLSLTFPSTSPQREARQDWPPIKSRLRDTLKGRRLLRRGDDTSLFVKVYMEGVPIGRKLDLCVFSGYESLLENLSHMFDTSIICGNRDRKHHVLTYEDKDGDWMMVGDIPWDMFLETVRRLKITRPERY CFE7F6AC0EA7F7D7 iaa32_arath Auxin-responsive protein IAA32 IAA32 Indoleacetic acid-induced protein 32 F10A8.8 At2g01200 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDPNTPADFFKGSSKFHTYYSQTKKGGGVIDLGLSLRTIQHETYLPPARMIGLDGYGELIDWSQPSYNSITQLKSEDTGHQRLAQGYYNNEGESRGKYAYVKVNLDGLVVGRKVCLVDQGAYATLALQLNDMFGMQTVSGLRLFQTESEFSLVYRDREGIWRNVGDVPWKEFVESVDRMRIARRNDALLPF 343D84427290F5F1 iaa10_arath Auxin-responsive protein IAA10 IAA10 Indoleacetic acid-induced protein 10 F20D22.13 At1g04100 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNGLQEVCSSSGSVMIGLPAEEDENAAHSSEDSSCPDESVSETELDLALGLSIGRRKVRSSLSSSSSSLTRESGTKRSADSSPAAASNATRQVAVGWPPLRTYRINSLVNQAKSLATEGGLSSGIQKETTKSVVVAAKNDDACFIKSSRTSMLVKVTMDGVIIGRKVDLNALDSYAALEKTLDLMFFQIPSPVTRSNTQGYKTIKETCTSKLLDGSSEYIITYQDKDGDWMLVGDVPWQMFLGSVTRLRIMKTSIGAGVGK DE99194344815A14 arfp_arath Auxin response factor 16 ARF16 F6G3.110 At4g30080 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MINVMNPMKGGTEKGLDPQLWHACAGGMVRMPPMNSKVFYFPQGHAENAYDCVDFGNLPIPPMVLCRVLAIKYMADAESDEVFAKLRLIPLKDDEYVDHEYGDGEDSNGFESNSEKTPSFAKTLTQSDANNGGGFSVPRYCAETIFPRLDYNAEPPVQTILAKDVHGDVWKFRHIYRGTPRRHLLTTGWSNFVNQKKLVAGDSIVFMRAENGDLCVGIRRAKRGGIGNGPEYSAGWNPIGGSCGYSSLLREDESNSLRRSNCSLADRKGKVTAESVIEAATLAISGRPFEVVYYPRASTSEFCVKALDARAAMRIPWCSGMRFKMAFETEDSSRISWFMGTVSAVNVSDPIRWPNSPWRLLQVAWDEPDLLQNVKRVNPWLVELVSNVHPIPLTSFSPPRKKMRLPQHPDYNNLINSIPVPSFPSNPLIRSSPLSSVLDNVPVGLQGARHNAHQYYGLSSSDLHHYYLNRPPPPPPPSSLQLSPSLGLRNIDTKNEKGFCFLTMGTTPCNDTKSKKSHIVLFGKLILPEEQLSEKGSTDTANIEKTQISSGGSNQNGVAGREFSSSDEGSPCSKKVHDASGLETGHCKVFMESDDVGRTLDLSVLGSYEELSRKLSDMFGIKKSEMLSSVLYRDASGAIKYAGNEPFSEFLKTARRLTILTEQGSESVVV DD5F5F761805457F arfg_arath Auxin response factor 7 Auxin-responsive protein IAA21/IAA23/IAA25 TIR5 Protein BIPOSTO ARF7 BIP IAA21 IAA23 IAA25 NPH4 At5g20730 T1M15.130 Protein NON-PHOTOTROPIC HYPOCOTYL 4 Protein TRANSPORT INHIBITOR RESPONSE 5 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKAPSSNGVSPNPVEGERRNINSELWHACAGPLISLPPAGSLVVYFPQGHSEQVAASMQKQTDFIPSYPNLPSKLICMLHNVTLNADPETDEVYAQMTLQPVNKYDRDALLASDMGLKLNRQPNEFFCKTLTASDTSTHGGFSVPRRAAEKIFPALDFSMQPPCQELVAKDIHDNTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIRDGKAQLLLGIRRANRQQPALSSSVISSDSMHIGVLAAAAHANANNSPFTIFYNPRAAPAEFVVPLAKYTKAMYAQVSLGMRFRMIFETEECGVRRYMGTVTGISDLDPVRWKNSQWRNLQIGWDESAAGDRPSRVSVWDIEPVLTPFYICPPPFFRPRFSGQPGMPDDETDMESALKRAMPWLDNSLEMKDPSSTIFPGLSLVQWMNMQQQNGQLPSAAAQPGFFPSMLSPTAALHNNLGGTDDPSKLLSFQTPHGGISSSNLQFNKQNQQAPMSQLPQPPTTLSQQQQLQQLLHSSLNHQQQQSQSQQQQQQQQLLQQQQQLQSQQHSNNNQSQSQQQQQLLQQQQQQQLQQQHQQPLQQQTQQQQLRTQPLQSHSHPQPQQLQQHKLQQLQVPQNQLYNGQQAAQQHQSQQASTHHLQPQLVSGSMASSVITPPSSSLNQSFQQQQQQSKQLQQAHHHLGASTSQSSVIETSKSSSNLMSAPPQETQFSRQVEQQQPPGLNGQNQQTLLQQKAHQAQAQQIFQQSLLEQPHIQFQLLQRLQQQQQQQFLSPQSQLPHHQLQSQQLQQLPTLSQGHQFPSSCTNNGLSTLQPPQMLVSRPQEKQNPPVGGGVKAYSGITDGGDAPSSSTSPSTNNCQISSSGFLNRSQSGPAILIPDAAIDMSGNLVQDLYSKSDMRLKQELVGQQKSKASLTDHQLEASASGTSYGLDGGENNRQQNFLAPTFGLDGDSRNSLLGGANVDNGFVPDTLLSRGYDSQKDLQNMLSNYGGVTNDIGTEMSTSAVRTQSFGVPNVPAISNDLAVNDAGVLGGGLWPAQTQRMRTYTKVQKRGSVGRSIDVNRYRGYDELRHDLARMFGIEGQLEDPQTSDWKLVYVDHENDILLVGDDPWEEFVNCVQSIKILSSAEVQQMSLDGNFAGVPVTNQACSGGDSGNAWRGHYDDNSATSFNR DIP protein P93022 original sequence version: 114 6A2858510130F5B1 iaa34_arath Auxin-responsive protein IAA34 IAA34 Indoleacetic acid-induced protein 34 T15D22.10 At1g15050 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MYCSDPPHPLHLVASDKQQKDHKLILSWKKPTMDSDPLGVFPNSPKYHPYYSQTTEFGGVIDLGLSLRTIQHEIYHSSGQRYCSNEGYRRKWGYVKVTMDGLVVGRKVCVLDHGSYSTLAHQLEDMFGMQSVSGLRLFQMESEFCLVYRDEEGLWRNAGDVPWNEFIESVERLRITRRNDAVLPF 83D4F89CFC657BB7 arfc_arath Auxin response factor 3 ARF3 ETT Protein ETTIN T1B8.30 At2g33860 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGGLIDLNVMETEEDETQTQTPSSASGSVSPTSSSSASVSVVSSNSAGGGVCLELWHACAGPLISLPKRGSLVLYFPQGHLEQAPDFSAAIYGLPPHVFCRILDVKLHAETTTDEVYAQVSLLPESEDIERKVREGIIDVDGGEEDYEVLKRSNTPHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLDYSQPRPSQELLARDLHGLEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLRGDDGKLRLGVRRASQIEGTAALSAQYNQNMNHNNFSEVAHAISTHSVFSISYNPKASWSNFIIPAPKFLKVVDYPFCIGMRFKARVESEDASERRSPGIISGISDLDPIRWPGSKWRCLLVRWDDIVANGHQQRVSPWEIEPSGSISNSGSFVTTGPKRSRIGFSSGKPDIPVSEGIRATDFEESLRFQRVLQGQEIFPGFINTCSDGGAGARRGRFKGTEFGDSYGFHKVLQGQETVPAYSITDHRQQHGLSQRNIWCGPFQNFSTRILPPSVSSSPSSVLLTNSNSPNGRLEDHHGGSGRCRLFGFPLTDETTAVASATAVPCVEGNSMKGASAVQSNHHHSQGRDIYAMRDMLLDIAL 4BE93292324D354B iaa14_arath Auxin-responsive protein IAA14 IAA14 SLR1 Indoleacetic acid-induced protein 14 Protein SOLITARY ROOT dl3315c FCAALL.254 At4g14550 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPKEKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQKSGEAEEAMSSGGGTVAFVKVSMDGAPYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVPSYEDKDGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKFKNRS DIP protein Q38832 original sequence version: 90 A76A9F733538E372 iaa26_arath Auxin-responsive protein IAA26 IAA26 PAP1 Indoleacetic acid-induced protein 26 Phytochrome-associated protein 1 MDC8.13 At3g16500 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEGCPRNREIGPKLLDLIPQGRKWYQEDKNNTDQEKKLELRLGPPGGDEEDHSAIKKKNTEIRNIKKETEDKSFHCFNGNHFSPSNKTTSVPHISQKRTAPGPVVGWPPVRSFRKNLASTSSSKLGNESSHGGQINKSDDGEKQVETKKEGMFVKINMDGVPIGRKVDLNAYNSYEQLSFVVDKLFRGLLAAQRDISDGQGEEKPIIGLLDGKGEFTLTYEDNEGDKMLVGDVPWQMFVSSVKRLRVIKSSEISSALTFGCSKQEKMMH 70CA1CECBD77CD0E iaa8_arath Auxin-responsive protein IAA8 Indoleacetic acid-induced protein 8 IAA8 At2g22670 T9I22.11 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSYRLLSVDKDELVTSPCLKERNYLGLSDCSSVDSSTIPNVVGKSNLNFKATELRLGLPESQSPERETDFGLLSPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWDEFSGVKGSVRPGGGINMMLSPKVKDVSKSIQEERSHAKGGLNNAPAAKAQVVGWPPIRSYRKNTMASSTSKNTDEVDGKPGLGVLFVKVSMDGAPYLRKVDLRTYTSYQQLSSALEKMFSCFTLGQCGLHGAQGRERMSEIKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEIFTETCQKLKIMKGSDSIGLAPGAVEKSKNKERV 645F2A5248BCE2FF iaa19_arath Auxin-responsive protein IAA19 Indoleacetic acid-induced protein 19 Protein MASSUGU 2 IAA19 MSG2 At3g15540 MJK13.20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEKEGLGLEITELRLGLPGRDVAEKMMKKRAFTEMNMTSSGSNSDQCESGVVSSGGDAEKVNDSPAAKSQVVGWPPVCSYRKKNSCKEASTTKVGLGYVKVSMDGVPYLRKMDLGSSQGYDDLAFALDKLFGFRGIGVALKDGDNCEYVTIYEDKDGDWMLAGDVPWGMFLESCKRLRIMKRSDATGFGLQPRGVDE DIP protein O24409 original sequence version: 103 84B332B780132B53 iaa6_arath Auxin-responsive protein IAA6 Indoleacetic acid-induced protein 6 IAA6 SHY1 F14G24.10 At1g52830 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAKEGLALEITELRLGLPGDNYSEISVCGSSKKKKRVLSDMMTSSALDTENENSVVSSVEDESLPVVKSQAVGWPPVCSYRRKKNNEEASKAIGYVKVSMDGVPYMRKIDLGSSNSYINLVTVLENLFGCLGIGVAKEGKKCEYIIIYEDKDRDWMLVGDVPWQMFKESCKRLRIVKRSDATGFGLQQD 5E9B130584A75465 grh1_arath GRR1-like protein 1 Protein AUXIN SIGNALING F-BOX 1 GRH1 AFB1 FBL18 GER1 LRF1 F4C21.11 At4g03190 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGLRFPPKVLEHILSFIDSNEDRNSVSLVCKSWFETERKTRKRVFVGNCYAVSPAAVTRRFPEMRSLTLKGKPHFADYNLVPDGWGGYAWPWIEAMAAKSSSLEEIRMKRMVVTDECLEKIAASFKDFKVLVLTSCEGFSTDGIAAIAATCRNLRVLELRECIVEDLGGDWLSYFPESSTSLVSLDFSCLDSEVKISDLERLVSRSPNLKSLKLNPAVTLDGLVSLLRCAPQLTELGTGSFAAQLKPEAFSKLSEAFSNCKQLQSLSGLWDVLPEYLPALYSVCPGLTSLNLSYATVRMPDLVELLRRCSKLQKLWVMDLIEDKGLEAVASYCKELRELRVFPSEPDLDATNIPLTEQGLVFVSKGCRKLESVLYFCVQFTNAALFTIARKRPNLKCFRLCVIEPFAPDYKTNEPLDKGFKAIAEGCRDLRRLSVSGLLSDKAFKYIGKHAKKVRMLSIAFAGDSDLMLHHLLSGCESLKKLEIRDCPFGDTALLEHAAKLETMRSLWMSSCFVSFGACKLLSQKMPRLNVEVIDEHPPESRPESSPVERIYIYRTVAGPRMDTPEFVWTIHKNPENGVSHLAIK DIP protein Q9ZR12 original sequence version: 61 D39D627C82864D83 iaa4_arath Auxin-responsive protein IAA4 Indoleacetic acid-induced protein 4 Auxin-induced protein AUX2-11 IAA4 AUX2-11 At5g43700 MQD19.3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEKVDVYDELVNLKATELRLGLPGTEETVSCGKSNKRVLPEATEKEIESTGKTETASPPKAQIVGWPPVRSYRKNNVQTKKSESEGQGNYVKVSMDGAPYLRKIDLTMYKQYPELMKSLENMFKFSVGEYFEREGYKGSDFVPTYEDKDGDWMLVGDVPWEMFVSSCKRLRIMKGSEVKGLGCGGL DCF66CAC4D28CD3B arfj_arath Auxin response factor 10 ARF10 T1B3.13 At2g28350 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEQEKSLDPQLWHACAGSMVQIPSLNSTVFYFAQGHTEHAHAPPDFHAPRVPPLILCRVVSVKFLADAETDEVFAKITLLPLPGNDLDLENDAVLGLTPPSSDGNGNGKEKPASFAKTLTQSDANNGGGFSVPRYCAETIFPRLDYSAEPPVQTVIAKDIHGETWKFRHIYRGTPRRHLLTTGWSTFVNQKKLIAGDSIVFLRSESGDLCVGIRRAKRGGLGSNAGSDNPYPGFSGFLRDDESTTTTSKLMMMKRNGNNDGNAAATGRVRVEAVAEAVARAACGQAFEVVYYPRASTPEFCVKAADVRSAMRIRWCSGMRFKMAFETEDSSRISWFMGTVSAVQVADPIRWPNSPWRLLQVAWDEPDLLQNVKRVSPWLVELVSNMPTIHLSPFSPRKKIRIPQPFEFPFHGTKFPIFSPGFANNGGGESMCYLSNDNNNAPAGIQGARQAQQLFGSPSPSLLSDLNLSSYTGNNKLHSPAMFLSSFNPRHHHYQARDSENSNNISCSLTMGNPAMVQDKKKSVGSVKTHQFVLFGQPILTEQQVMNRKRFLEEEAEAEEEKGLVARGLTWNYSLQGLETGHCKVFMESEDVGRTLDLSVIGSYQELYRKLAEMFHIEERSDLLTHVVYRDANGVIKRIGDEPFSDFMKATKRLTIKMDIGGDNVRKTWITGIRTGENGIDASTKTGPLSIFA 6D3002534DC6F9E7 arfi_arath Auxin response factor 9 ARF9 T19F6.20 T32A16.150 At4g23980 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MANRGGEYLYDELWKLCAGPLVDVPQAQERVYYFPQGHMEQLEASTQQVDLNTMKPLFVLPPKILCNVMNVSLQAEKDTDEVYAQITLIPVGTEVDEPMSPDPSPPELQRPKVHSFSKVLTASDTSTHGGFSVLRKHATECLPPLDMTQQTPTQELVAEDVHGYQWKFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDTFVFLRGENGELRVGVRRANLQQSSMPSSVISSHSMHLGVLATARHATQTKTMFIVYYKPRTSQFIISLNKYLEAMSNKFSVGMRFKMRFEGEDSPERRYSGTVIGVKDCSPHWKDSKWRCLEVHWDEPASISRPNKVSPWEIEPFVNSENVPKSVMLKNKRPRQVSEVSALDVGITASNLWSSVLTQPHEFAQSCITSQWSSPQQCHRDANEDAKKSDWLNNSYSVSNVAKDSTLNDQMVSPVEQKKPETTANYRLFGIDLMSSSLAVPEEKTAPMRPINISKPTMDSHSDPKSEISKVSEEKKQEPAEGSPKEVQSKQSSSTRSRTKVQMQGVPVGRAVDLNALKGYNELIDDIEKLFDIKGELRSRNQWEIVFTDDEGDMMLVGDDPWPEFCNMVKRIFIWSKEEVKKMTPGNQLRMLLREVETTLTTTSKTDNHSN 6EBA72A9F8909C82 arfn_arath Putative auxin response factor 14 ARF14 F15O4.37 At1g35540 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MESGNVVNTQPELSGIIDGSKSYMYEQLWKLCAGPLCDIPKLGEKVYYFPQGHIELVEASTREELNELQPICDFPSKLQCRVIAIQLKVENNSDETYAEITLMPDTTQVVIPTQNQNQFRPLVNSFTKVLTASDTSVHGGFSVPKKHAIECLPPLDMSQPLPTQEILAIDLHGNQWRFRHIYRGTAQRHLLTIGWNAFTTSKKLVEGDVIVFVRGETGELRVGIRRAGHQQGNIPSSIVSIESMRHGIIASAKHAFDNQCMFIVVYKPRSSQFIVSYDKFLDVVNNKFNVGSRFTMRFEGDDFSERRSFGTIIGVSDFSPHWKCSEWRSLEVQWDEFASFPRPNQVSPWDIEHLTPWSNVSRSSFLKNKRSREVNEIGSSSSHLLPPTLTQGQEIGQQSMATPMNISLRYRDITEDAMTPSRLLMSYPVQPMAKLNYNNVVTPIEENITTNAVASFRLFGVSLATPSVIKDPVEQIGLEISRLTQEKKFGQSQILRSPTEIQSKQFSSTRTCTKVQMQGVTIGRAVDLSVLNGYDQLILELEKLFDLKGQLQARNQWEIAFTNNEEDKMLVGEDPWPEFCNMVKKIFIYSKEEVKNLKSRKSLSS 629D3B40BED65A24 arft_arath Auxin response factor 20 ARF20 T9I1.3 At1g35240 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress METGNVVNAQPELSGIIDGSKSYMYEQLWKLCAGPLCDIPKLGENVYYFPQGNIELVDASTREELNELQPICDLPSKLQCRVIAIHLKVENNSDETYAEITLMPDTTQVVIPTQSENQFRPLVNSFTKVLTASDTSAYGGFFVPKKHAIECLPPLPLPAQELLAKDLHGNQWRFRHSYRGTPQRHSLTTGWNEFTTSKKLVKGDVIVFVRGETGELRVGIRRARHQQGNIPSSIVSIDCMRHGVIASAKHALDNQCIFIVVYKPSIRSSQFIVSYDKFLDAMNNKFIVGSRFTMRFEGDDFSERRYFGTIIGVNDFSPHWKCSEWRSLEVQWDEFASFSRPNKVSPWEIEHLMSALNVPRSSLLKNKRLREVNEFGQEIGQLSVASPMNTSLRYRDTTEDAMNPSRLLMSYPVQPMPKLNYNNQMVTQIEENITTKAVTNFRLFGVSLAIPLVIKDPIEEIGSDISKLTEGKKFGQSQTLRSPIEIQSKQFGSTRTCTKVQMQGVTIGRAVDLSVLNGYDQLILELEKLFDLKGQLQTRNQWKIAFTDSDGYEMLVGDDPWPEFCKMVKKILIYSKEEVKNLKSSKSLSS 8332DD4BA48CA628 iaa3_arath Auxin-responsive protein IAA3 IAA3 SHY2 At1g04240 F19P19.32 Indoleacetic acid-induced protein 3 Short hypocotyl Suppressor of HY2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDEFVNLKETELRLGLPGTDNVCEAKERVSCCNNNNKRVLSTDTEKEIESSSRKTETSPPRKAQIVGWPPVRSYRKNNIQSKKNESEHEGQGIYVKVSMDGAPYLRKIDLSCYKGYSELLKALEVMFKFSVGEYFERDGYKGSDFVPTYEDKDGDWMLIGDVPWEMFICTCKRLRIMKGSEAKGLGCGV DIP protein Q38822 original sequence version: 82 DIP protein Q38822 original sequence version: 104 8627A4173363EF27 iaa12_arath Auxin-responsive protein IAA12 Indoleacetic acid-induced protein 12 Protein BODENLOS IAA12 BDL At1g04550 T1G11.20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRGVSELEVGKSNLPAESELELGLGLSLGGGAWKERGRILTAKDFPSVGSKRSAESSSHQGASPPRSSQVVGWPPIGLHRMNSLVNNQAMKAARAEEGDGEKKVVKNDELKDVSMKVNPKVQGLGFVKVNMDGVGIGRKVDMRAHSSYENLAQTLEEMFFGMTGTTCREKVKPLRLLDGSSDFVLTYEDKEGDWMLVGDVPWRMFINSVKRLRIMGTSEASGLAPRRQEQKDRQRNNPV BBAADA3E98B222CA iaa17_arath Auxin-responsive protein IAA17 Indoleacetic acid-induced protein 17 Auxin response 3 IAA17 AXR3 At1g04250 F19P19.31 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMGSVELNLRETELCLGLPGGDTVAPVTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSSGGPEAAAFVKVSMDGAPYLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSRA DIP protein P93830 original sequence version: null ECEA39207476581E iaa9_arath Auxin-responsive protein IAA9 Indoleacetic acid-induced protein 9 IAA9 At5g65670 F6H11.210 MPA24.1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSPEEELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKATISLKATELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSDTMDQFAEAKSSVYTEKNWMFPEAAATQSVTKKDVPQNIPKGQSSTTNNSSSPPAAKAQIVGWPPVRSYRKNTLATTCKNSDEVDGRPGSGALFVKVSMDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSNGAAGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAIGLAAAPRAMEKSKMRA F13BE50C222F6B42 arfs_arath Auxin response factor 19 Auxin-responsive protein IAA22 ARF19 IAA22 At1g19220 T29M8.9 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKAPSNGFLPSSNEGEKKPINSQLWHACAGPLVSLPPVGSLVVYFPQGHSEQVAASMQKQTDFIPNYPNLPSKLICLLHSVTLHADTETDEVYAQMTLQPVNKYDREALLASDMGLKLNRQPTEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDFSMQPPAQEIVAKDLHDTTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFVRDEKSQLMLGIRRANRQTPTLSSSVISSDSMHIGILAAAAHANANSSPFTIFFNPRASPSEFVVPLAKYNKALYAQVSLGMRFRMMFETEDCGVRRYMGTVTGISDLDPVRWKGSQWRNLQVGWDESTAGDRPSRVSIWEIEPVITPFYICPPPFFRPKYPRQPGMPDDELDMENAFKRAMPWMGEDFGMKDAQSSMFPGLSLVQWMSMQQNNPLSGSATPQLPSALSSFNLPNNFASNDPSKLLNFQSPNLSSANSQFNKPNTVNHISQQMQAQPAMVKSQQQQQQQQQQHQHQQQQLQQQQQLQMSQQQVQQQGIYNNGTIAVANQVSCQSPNQPTGFSQSQLQQQSMLPTGAKMTHQNINSMGNKGLSQMTSFAQEMQFQQQLEMHNSSQLLRNQQEQSSLHSLQQNLSQNPQQLQMQQQSSKPSPSQQLQLQLLQKLQQQQQQQSIPPVSSSLQPQLSALQQTQSHQLQQLLSSQNQQPLAHGNNSFPASTFMQPPQIQVSPQQQGQMSNKNLVAAGRSHSGHTDGEAPSCSTSPSANNTGHDNVSPTNFLSRNQQQGQAASVSASDSVFERASNPVQELYTKTESRISQGMMNMKSAGEHFRFKSAVTDQIDVSTAGTTYCPDVVGPVQQQQTFPLPSFGFDGDCQSHHPRNNLAFPGNLEAVTSDPLYSQKDFQNLVPNYGNTPRDIETELSSAAISSQSFGIPSIPFKPGCSNEVGGINDSGIMNGGGLWPNQTQRMRTYTKVQKRGSVGRSIDVTRYSGYDELRHDLARMFGIEGQLEDPLTSDWKLVYTDHENDILLVGDDPWEEFVNCVQNIKILSSVEVQQMSLDGDLAAIPTTNQACSETDSGNAWKVHYEDTSAAASFNR DIP protein Q8RYC8 original sequence version: 93 202C0944581E0545 tir1_arath Protein TRANSPORT INHIBITOR RESPONSE 1 TIR1 FBL1 WEI1 T20O10.80 At3g62980 Weak ethylene-insensitive protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQKRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVSPATVIRRFPKVRSVELKGKPHFADFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLKELDLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALERLVTRCPNLKSLKLNRAVPLEKLATLLQRAPQLEELGTGGYTAEVRPDVYSGLSVALSGCKELRCLSGFWDAVPAYLPAVYSVCSRLTTLNLSYATVQSYDLVKLLCQCPKLQRLWVLDYIEDAGLEVLASTCKDLRELRVFPSEPFVMEPNVALTEQGLVSVSMGCPKLESVLYFCRQMTNAALITIARNRPNMTRFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLSGLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGCDSLRKLEIRDCPFGDKALLANASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDERGAPDSRPESCPVERVFIYRTVAGPRFDMPGFVWNMDQDSTMRFSRQIITTNGL DIP protein Q570C0 original sequence version: 83 DIP protein Q570C0 original sequence version: 40 DIP protein Q570C0 original sequence version: 86 DIP protein Q570C0 original sequence version: 60 9E19ED5DABF40D07 arfd_arath Auxin response factor 4 ARF4 MUF9.8 At5g60450 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEFDLNTEIAEVEEEENDDVGVGVGGGTRIDKGRLGISPSSSSSCSSGSSSSSSSTGSASSIYSELWHACAGPLTCLPKKGNVVVYFPQGHLEQDAMVSYSSPLEIPKFDLNPQIVCRVVNVQLLANKDTDEVYTQVTLLPLQEFSMLNGEGKEVKELGGEEERNGSSSVKRTPHMFCKTLTASDTSTHGGFSVPRRAAEDCFAPLDYKQQRPSQELIAKDLHGVEWKFRHIYRGQPRRHLLTTGWSIFVSQKNLVSGDAVLFLRDEGGELRLGIRRAARPRNGLPDSIIEKNSCSNILSLVANAVSTKSMFHVFYSPRATHAEFVIPYEKYITSIRSPVCIGTRFRMRFEMDDSPERRCAGVVTGVCDLDPYRWPNSKWRCLLVRWDESFVSDHQERVSPWEIDPSVSLPHLSIQSSPRPKRPWAGLLDTTPPGNPITKRGGFLDFEESVRPSKVLQGQENIGSASPSQGFDVMNRRILDFAMQSHANPVLVSSRVKDRFGEFVDATGVNPACSGVMDLDRFPRVLQGQEICSLKSFPQFAGFSPAAAPNPFAYQANKSSYYPLALHGIRSTHVPYQNPYNAGNQSSGPPSRAINFGEETRKFDAQNEGGLPNNVTADLPFKIDMMGKQKGSELNMNASSGCKLFGFSLPVETPASKPQSSSKRICTKVHKQGSQVGRAIDLSRLNGYDDLLMELERLFNMEGLLRDPEKGWRILYTDSENDMMVVGDDPWHDFCNVVWKIHLYTKEEVENANDDNKSCLEQAALMMEASKSSSVSQPDSSPTITRV BF9D5056D1DD7A6F arfv_arath Auxin response factor 22 ARF22 F7P12.6 At1g34390 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MESGNIVNAQPELSGIIDGSKSYMYEQLWKLCAGPLCDIPKLGEKIYYFPQGNIELVEASTREELNELKPICDLPSKLQCRVIAIQLKVENNSDETYAEITLMPDTTQVVIPTQNENQFRPLVNSFTKVLTASDTSGGFFVPKKHAIECLPPLDMSQPLPTQELLATDLHGNQWRFNHNYRGTPQRHLLTTGWNAFTTSKKLVAGDVIVFVRGETGELRVGIRRAGHQQGNIPSSIISIESMRHGVIASAKHAFDNQCMFIVVYKPRSSQFIVSYDKFLDAVNNKFNVGSRFTMRFEGDDFSERRYFGTIIGVSDFSPHWKCSEWRNLEVQWDEFASFSRPNKVSPWEIEHLMPALNVPRPSLLKNKRLREVNEIGSSSSHLLPPILTQGQEIGQLSVASPMNISLTYRDTTEDVMNPSRLLMSYPVQPMPKLNYNNQMVTQIEENITTKTGTNFRLFGVSLVTPSVIKDPIEEIGSEISKLTEGKKFGQSQTLRSPTEIQSKQFSSTRTCTKVQMQGVTIERAVDLSVLNGYDQLILELEELFDLKGQLQTRNQWEIAFTDSDDDKMLVGDDPWPEFCNMVKKILIFKRGGQKLEVQ 1F9A79C4BD932D94 iaa28_arath Auxin-responsive protein IAA28 IAA28 Indoleacetic acid-induced protein 28 T1N24.24 F18A17.6 At5g25890 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEEKRLELRLAPPCHQFTSNNNINGSKQKSSTKETSFLSNNRVEVAPVVGWPPVRSSRRNLTAQLKEEMKKKESDEEKELYVKINMEGVPIGRKVNLSAYNNYQQLSHAVDQLFSKKDSWDLNRQYTLVYEDTEGDKVLVGDVPWEMFVSTVKRLHVLKTSHAFSLSPRKHGKE 7A58B615DBC8FB47 iaa33_arath Auxin-responsive protein IAA33 IAA33 Indoleacetic acid-induced protein 33 MUA2.1 At5g57420 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNSFEPQSQDSLQRRFHQDNSTTQQPRDTTTPFIPKPASKNHNNSNSSSGAAGRSFQGFGLNVEDDLVSSVVPPVTVVLEGRSICQRISLDKHGSYQSLASALRQMFVDGADSTDDLDLSNAIPGHLIAYEDMENDLLLAGDLTWKDFVRVAKRIRILPVKGNTRQVKRNE B41460826FFE9BDC iaa29_arath Auxin-responsive protein IAA29 IAA29 Indoleacetic acid-induced protein 29 F10M6.80 At4g32280 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MELDLGLSLSPHKSSKLGFNFDLNKHCAIEGAASCLGTEKLRFEATFGLGNVEENCYMPKQRLFALNGQPNEEDEDPLESESSIVYDDEEENSEVVGWPPVKTCMIKYGSYHHRHIRNHHHCPYHHRGRRITAMNNNISNPTTATVGSSSSSSISSRSSMYVKVKMDGVAIARKVDIKLFNSYESLTNSLITMFTEYEDCDREDTNYTFTFQGKEGDWLLRGDVTWKIFAESVHRISIIRDRPCAYTRCLF 47A6ECBD4F0ECC3B arfq_arath Auxin response factor 17 ARF17 F28K19.6 T32E8.16 At1g77850 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSPPSATAGDINHREVDPTIWRACAGASVQIPVLHSRVYYFPQGHVEHCCPLLSTLPSSTSPVPCIITSIQLLADPVTDEVFAHLILQPMTQQQFTPTNYSRFGRFDGDVDDNNKVTTFAKILTPSDANNGGGFSVPRFCADSVFPLLNFQIDPPVQKLYVTDIHGAVWDFRHIYRGTPRRHLLTTGWSKFVNSKKLIAGDSVVFMRKSADEMFIGVRRTPISSSDGGSSYYGGDEYNGYYSQSSVAKEDDGSPKKTFRRSGNGKLTAEAVTDAINRASQGLPFEVVFYPAAGWSEFVVRAEDVESSMSMYWTPGTRVKMAMETEDSSRITWFQGIVSSTYQETGPWRGSPWKQLQITWDEPEILQNVKRVNPWQVEIAAHATQLHTPFPPAKRLKYPQPGGGFLSGDDGEILYPQSGLSSAAAPDPSPSMFSYSTFPAGMQGARQYDFGSFNPTGFIGGNPPQLFTNNFLSPLPDLGKVSTEMMNFGSPPSDNLSPNSNTTNLSSGNDLVGNRGPLSKKVNSIQLFGKIITVEEHSESGPAESGLCEEDGSKESSDNETQLSLSHAPPSVPKHSNSNAGSSSQG C36984B4326B8620 iaa7_arath Auxin-responsive protein IAA7 Indoleacetic acid-induced protein 7 Auxin resistant 2 IAA7 AXR2 At3g23050 MXC7.8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MIGQLMNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLKNVSAVPKEKTTLKDPSKPPAKAQVVGWPPVRNYRKNMMTQQKTSSGAEEASSEKAGNFGGGAAGAGLVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAVGLAPRAMEKYCKNRS DIP protein Q38825 original sequence version: 111 DIP protein Q38825 original sequence version: 70 DIP protein Q38825 original sequence version: 88 830E9B9EA2C2B5D0 arfm_arath Auxin response factor 13 ARF13 F12G12.1 F23M19.15 At1g34170 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MENNGEMNAQPELSVDITKTYMYEKLWNICAGPLCVLPKPGEKVYYFPQGHIELIENSTRDELDHIRPIFDLPSKLRCRVVAIDRKVDKNTDEVYAQISLMPDTTEVMTHNTTMDTRRPIVYFFSKILTASDVSLSGGLIIPKQYAIECFPPLDMSQPISTQNLVAKDLYGQEWSFKHVFRGTPQRHMFTSGGGWSVFATTKRLIVGDIFVLLRGENGELRFGIRRAKHQQGHIPSSVISANCMQHGVIASVVNAFKTKCMFNVVYKPSSSQFVISYDKFVDAMNNNYIVGSRFRMQFEGKDFSEKRYDGTIIGVNDMSPHWKDSEWRSLKVQWDELSPFLRPNQVSPWDIEHLIPSSDISQSSLKKKKHWLQLNEIGATLSNLWTCQEIGQRSMNSPISVPEFSYPNAIEDSKFLSGLLLNHSLLAIPNENYNSDQMIQPRKEDITTEATTSCLLFGVDLTKVSKSKDSICPIESCKKSLPQDKKFDQTQPLRSPKEVQSTEFNFTRSRIKVHMQGVAISRAVDLTAMHGYNQLIQKLEELFDLKDELRTRNQWEIVFTNNEGAEMLVGDDPWPEFCNMAKRIFICSKEEIKKMKLKNKFFQPESKALTSSDVPPNVTDN 7876C26E55A58AAF tir1l_arath Transport inhibitor response 1-like protein K9P8.12 At5g49980 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTQDRSEMSEDDDDQQSPPLDLPSTAIADPCSSSSSPNKSRNCISNSQTFPDHVLENVLENVLQFLDSRCDRNAASLVCKSWWRVEALTRSEVFIGNCYALSPARLTQRFKRVRSLVLKGKPRFADFNLMPPDWGANFAPWVSTMAQAYPCLEKVDLKRMFVTDDDLALLADSFPGFKELILVCCEGFGTSGISIVANKCRKLKVLDLIESEVTDDEVDWISCFPEDVTCLESLAFDCVEAPINFKALEGLVARSPFLKKLRLNRFVSLVELHRLLLGAPQLTSLGTGSFSHDEEPQSEQEPDYAAAFRACKSVVCLSGFRELMPEYLPAIFPVCANLTSLNFSYANISPDMFKPIILNCHKLQVFWALDSICDEGLQAVAATCKELRELRIFPFDPREDSEGPVSELGLQAISEGCRKLESILYFCQRMTNAAVIAMSENCPELTVFRLCIMGRHRPDHVTGKPMDEGFGAIVKNCKKLTRLAVSGLLTDQAFRYMGEYGKLVRTLSVAFAGDSDMALRHVLEGCPRLQKLEIRDSPFGDVALRSGMHRYYNMRFVWMSACSLSKGCCKDIARAMPNLVVEVIGSDDDDDNRDYVETLYMYRSLDGPRNDAPKFVTIL D0614AF071EE4FD2 arfb_arath Auxin response factor 2 ARF2 ARF1-binding protein MTG10.3 At5g62000 MNT Protein MEGAINTEGUMENTA protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASSEVSMKGNRGGDNFSSSGFSDPKETRNVSVAGEGQKSNSTRSAAAERALDPEAALYRELWHACAGPLVTVPRQDDRVFYFPQGHIEQVEASTNQAAEQQMPLYDLPSKLLCRVINVDLKAEADTDEVYAQITLLPEANQDENAIEKEAPLPPPPRFQVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSRQPPTQELVAKDLHANEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFLRGENGELRVGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAISTGTMFTVYYKPRTSPSEFIVPFDQYMESVKNNYSIGMRFKMRFEGEEAPEQRFTGTIVGIEESDPTRWPKSKWRSLKVRWDETSSIPRPDRVSPWKVEPALAPPALSPVPMPRPKRPRSNIAPSSPDSSMLTREGTTKANMDPLPASGLSRVLQGQEYSTLRTKHTESVECDAPENSVVWQSSADDDKVDVVSGSRRYGSENWMSSARHEPTYTDLLSGFGTNIDPSHGQRIPFYDHSSSPSMPAKRILSDSEGKFDYLANQWQMIHSGLSLKLHESPKVPAATDASLQGRCNVKYSEYPVLNGLSTENAGGNWPIRPRALNYYEEVVNAQAQAQAREQVTKQPFTIQEETAKSREGNCRLFGIPLTNNMNGTDSTMSQRNNLNDAAGLTQIASPKVQDLSDQSKGSKSTNDHREQGRPFQTNNPHPKDAQTKTNSSRSCTKVHKQGIALGRSVDLSKFQNYEELVAELDRLFEFNGELMAPKKDWLIVYTDEENDMMLVGDDPWQEFCCMVRKIFIYTKEEVRKMNPGTLSCRSEEEAVVGEGSDAKDAKSASNPSLSSAGNS 6B75171D7FF0E66B arfe_arath Auxin response factor 5 Transcription factor MONOPTEROS Auxin-responsive protein IAA24 ARF5 IAA24 MP At1g19850 F6F9.10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMASLSCVEDKMKTSCLVNGGGTITTTTSQSTLLEEMKLLKDQSGTRKPVINSELWHACAGPLVCLPQVGSLVYYFSQGHSEQVAVSTRRSATTQVPNYPNLPSQLMCQVHNVTLHADKDSDEIYAQMSLQPVHSERDVFPVPDFGMLRGSKHPTEFFCKTLTASDTSTHGGFSVPRRAAEKLFPPLDYSAQPPTQELVVRDLHENTWTFRHIYRGQPKRHLLTTGWSLFVGSKRLRAGDSVLFIRDEKSQLMVGVRRANRQQTALPSSVLSADSMHIGVLAAAAHATANRTPFLIFYNPRACPAEFVIPLAKYRKAICGSQLSVGMRFGMMFETEDSGKRRYMGTIVGISDLDPLRWPGSKWRNLQVEWDEPGCNDKPTRVSPWDIETPESLFIFPSLTSGLKRQLHPSYFAGETEWGSLIKRPLIRVPDSANGIMPYASFPSMASEQLMKMMMRPHNNQNVPSFMSEMQQNIVMGNGGLLGDMKMQQPLMMNQKSEMVQPQNKLTVNPSASNTSGQEQNLSQSMSAPAKPENSTLSGCSSGRVQHGLEQSMEQASQVTTSTVCNEEKVNQLLQKPGASSPVQADQCLDITHQIYQPQSDPINGFSFLETDELTSQVSSFQSLAGSYKQPFILSSQDSSAVVLPDSTNSPLFHDVWDTQLNGLKFDQFSPLMQQDLYASQNICMSNSTTSNILDPPLSNTVLDDFCAIKDTDFQNHPSGCLVGNNNTSFAQDVQSQITSASFADSQAFSRQDFPDNSGGTGTSSSNVDFDDCSLRQNSKGSSWQKIATPRVRTYTKVQKTGSVGRSIDVTSFKDYEELKSAIECMFGLEGLLTHPQSSGWKLVYVDYESDVLLVGDDPWEEFVGCVRCIRILSPTEVQQMSEEGMKLLNSAGINDLKTSVS D20D348369757F09 iaa30_arath Auxin-responsive protein IAA30 IAA30 Indoleacetic acid-induced protein 30 T17J13.60 At3g62100 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRSSSSSSIESSCKSNPFGVSSSNTRNLSTDLRLGLSFGSSSGQYYNGGDNHEYDGVGAAEEMMIMEEEEQNECNSVGSFYVKVNMEGVPIGRKIDLLSLNGYHDLITTLDYMFNASILWAEEEDMCSEKSHVLTYADKEGDWMMVGDVPWEMFLSSVRRLKISRAYHY 44124F09674FF4B8 arfa_arath Auxin response factor 1 ARF1 F23H11.7 At1g59750 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAASNHSSGKPGGVLSDALCRELWHACAGPLVTLPREGERVYYFPEGHMEQLEASMHQGLEQQMPSFNLPSKILCKVINIQRRAEPETDEVYAQITLLPELDQSEPTSPDAPVQEPEKCTVHSFCKTLTASDTSTHGGFSVLRRHADDCLPPLDMSQQPPWQELVATDLHNSEWHFRHIFRGQPRRHLLTTGWSVFVSSKKLVAGDAFIFLRGENEELRVGVRRHMRQQTNIPSSVISSHSMHIGVLATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEGEEAPEKRFSGTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLVANSTPSSQPQPPQRNKRPRPPGLPSPATGPSGPVTPDGVWKSPADTPSSVPLFSPPAKAATFGHGGNKSFGVSIGSAFWPTNADSAAESFASAFNNESTEKKQTNGNVCRLFGFELVENVNVDECFSAASVSGAVAVDQPVPSNEFDSGQQSEPLNINQSDIPSGSGDPEKSSLRSPQESQSRQIRSCTKVHMQGSAVGRAIDLTRSECYEDLFKKLEEMFDIKGELLESTKKWQVVYTDDEDDMMMVGDDPWNEFCGMVRKIFIYTPEEVKKLSPKNKLAVNARMQLKADAEENGNTEGRSSSMAGSR 79DD3180C2091401 arff_arath Auxin response factor 6 ARF6 T4K22.6 At1g30330 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRLSSAGFNPQPHEVTGEKRVLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTNKEVDAHIPNYPSLHPQLICQLHNVTMHADVETDEVYAQMTLQPLNAQEQKDPYLPAELGVPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELMARDLHDNEWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRANRPQTVMPSSVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRMLFETEESSVRRYMGTITGICDLDPTRWANSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFPLRLKRPWPPGLPSFHGLKEDDMGMSMSSPLMWDRGLQSLNFQGMGVNPWMQPRLDTSGLLGMQNDVYQAMAAAALQDMRGIDPAKAAASLLQFQNSPGFSMQSPSLVQPQMLQQQLSQQQQQLSQQQQQQQQLSQQQQQQLSQQQQQQLSQQQQQQLSQQQQQQAYLGVPETHQPQSQAQSQSNNHLSQQQQQVVDNHNPSASSAAVVSAMSQFGSASQPNTSPLQSMTSLCHQQSFSDTNGGNNPISPLHTLLSNFSQDESSQLLHLTRTNSAMTSSGWPSKRPAVDSSFQHSGAGNNNTQSVLEQLGQSHTSNVPPNAVSLPPFPGGRECSIEQEGSASDPHSHLLFGVNIDSSSLLMPNGMSNLRSIGIEGGDSTTLPFTSSNFNNDFSGNLAMTTPSSCIDESGFLQSSENLGSENPQSNTFVKVYKSGSFGRSLDISKFSSYHELRSELARMFGLEGQLEDPVRSGWQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGKRGLELLNSAPSSNNVDKLPSNGNCDDFGNRSDPRNLGNGIASVGGSFNY 8A7A1621A0E934E3 arfh_arath Auxin response factor 8 ARF8 K15O15.5 At5g37020 FWF Protein FRUIT WITHOUT FERTILIZATION protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKLSTSGLGQQGHEGEKCLNSELWHACAGPLVSLPSSGSRVVYFPQGHSEQVAATTNKEVDGHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPEEQKETFVPIELGIPSKQPSNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYTLQPPAQELIARDLHDVEWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVIFIRNEKNQLFLGIRHATRPQTIVPSSVLSSDSMHIGLLAAAAHASATNSCFTVFFHPRASQSEFVIQLSKYIKAVFHTRISVGMRFRMLFETEESSVRRYMGTITGISDLDSVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSLFPLRLKRPWHAGTSSLPDGRGDLGSGLTWLRGGGGEQQGLLPLNYPSVGLFPWMQQRLDLSQMGTDNNQQYQAMLAAGLQNIGGGDPLRQQFVQLQEPHHQYLQQSASHNSDLMLQQQQQQQASRHLMHAQTQIMSENLPQQNMRQEVSNQPAGQQQQLQQPDQNAYLNAFKMQNGHLQQWQQQSEMPSPSFMKSDFTDSSNKFATTASPASGDGNLLNFSITGQSVLPEQLTTEGWSPKASNTFSEPLSLPQAYPGKSLALEPGNPQNPSLFGVDPDSGLFLPSTVPRFASSSGDAEASPMSLTDSGFQNSLYSCMQDTTHELLHGAGQINSSNQTKNFVKVYKSGSVGRSLDISRFSSYHELREELGKMFAIEGLLEDPLRSGWQLVFVDKENDILLLGDDPWESFVNNVWYIKILSPEDVHQMGDHGEGSGGLFPQNPTHL 730564020F8BB134 iaa15_arath Auxin-responsive protein IAA15 IAA15 Indoleacetic acid-induced protein 15 F5I6.14 At1g80390 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSPEEYVRVWPDSGDLGGTELTLALPGTPTNASEGPKKFGNKRRFLETVDLKLGEAHENNYISSMVTNDQLVGWPPVATARKTVRRKYVKVALDGAAYLRKVDLGMYDCYGQLFTALENMFQGIITICRVTELERKGEFVATYEDKDGDLMLVGDVPWMMFVESCKRMRLMKTGDAIGL 158AFC5F97419418 arfr_arath Auxin response factor 18 ARF18 F15G16.220 At3g61830 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASVEGDDDFGSSSSRSYQDQLYTELWKVCAGPLVEVPRAQERVFYFPQGHMEQLVASTNQGINSEEIPVFDLPPKILCRVLDVTLKAEHETDEVYAQITLQPEEDQSEPTSLDPPIVGPTKQEFHSFVKILTASDTSTHGGFSVLRKHATECLPSLDMTQATPTQELVTRDLHGFEWRFKHIFRGQPRRHLLTTGWSTFVSSKRLVAGDAFVFLRGENGDLRVGVRRLARHQSTMPTSVISSQSMHLGVLATASHAVRTTTIFVVFYKPRISQFIVGVNKYMEAIKHGFSLGTRFRMRFEGEESPERIFTGTIVGSGDLSSQWPASKWRSLQVQWDEPTTVQRPDKVSPWEIEPFLATSPISTPAQQPQSKCKRSRPIEPSVKTPAPPSFLYSLPQSQDSINASLKLFQDPSLERISGGYSSNNSFKPETPPPPTNCSYRLFGFDLTSNSPAPIPQDKQPMDTCGAAKCQEPITPTSMSEQKKQQTSRSRTKVQMQGIAVGRAVDLTLLKSYDELIDELEEMFEIQGQLLARDKWIVVFTDDEGDMMLAGDDPWNEFCKMAKKIFIYSSDEVKKMTTKLKISSSLENEEYGNESFENRSRG DIP protein Q9C5W9 original sequence version: null EC299D42B1A1C0BD iaa20_arath Auxin-responsive protein IAA20 Indoleacetic acid-induced protein 20 IAA20 At2g46990 F14M4.18 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRSSSSSSIESSSKSNPFGASSSTRNLSTDLRLGLSFGTSSGTQYFNGGYGYSVAAPAVEDAEYVAAVEEEEENECNSVGSFYVKVNMEGVPIGRKIDLMSLNGYRDLIRTLDFMFNASILWAEEEDMCNEKSHVLTYADKEGDWMMVGDVPWEMFLSTVRRLKISRANYHY A0DE41A5E4359F3B iaa11_arath Auxin-responsive protein IAA11 IAA11 Indoleacetic acid-induced protein 11 T5F17.90 At4g28640 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEGGSASGSASALSNDENLVVSCEDSSSPIGNELELGLTLSLGRKGYRDCRVYADDSSSSSSSSSLSRASVIAGIKRTADSMAATSGQVVGWPPIRTYRMNSMVNQAKASATEDPNLEISQAVNKNRSDSTKMRNSMFVKVTMDGIPIGRKIDLNAHKCYESLSNTLEEMFLKPKLGSRTLETDGHMETPVKILPDGSSGLVLTYEDKEGDWMLVGDVPWGMFIGSVRRLRIMKTSEATGKAQMIL 449054E312FBBDAD iaa16_arath Auxin-responsive protein IAA16 Indoleacetic acid-induced protein 16 IAA16 At3g04730 F7O18.22 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MINFEATELRLGLPGGNHGGEMAGKNNGKRGFSETVDLKLNLSSTAMDSVSKVDLENMKEKVVKPPAKAQVVGWPPVRSFRKNVMSGQKPTTGDATEGNDKTSGSSGATSSASACATVAYVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS 3575B0C2A0AB595E arfl_arath Auxin response factor 12 ARF12 F23M19.4 At1g34310 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MESGNVVNAQPELSGIIDGSKSYVYEQLWKLCAGPLCDIPKLGEKVYYFPQGHIELVETSTREELNELQPICDLPSKLQCRVIAIHLKVENNSDETYAEITLMPDTTQVVIPTQNENQFRPLVNSFTKVLTASDTSAHGGFFVPKKHAIECLPSLDMSQPLPAQELLAIDLHGNQWRFNHNYRGTPQRHLLTTGWNAFTTSKKLVAGDVIVFVRGETGELRVGIRRARHQQGNIPSSIVSIDCMRHGVVASAKHAFDNQCMFTVVYKPRSSKFIVSYDKFLDAVNNKFNVGSRFTMRLEGDDFSERRCFGTIIGVSDFSPHWKCSEWRSLEVQWDEFTSFPGPKKVSPWDIEHLMPAINVPRSFLLKNKRLREVNEIGSSSSHLLPPILTQGQENEQLSVASPMNISLRYRDATEDAMNPSKLLMSYPVQPMPKLNYNNQMVTEMEENITTKTGTNFRLFGVTLDTPPVIKDPIEEIGSEISKLTEGKKFGLSQTLRSPTEIQNKQFSSSRTCTKVQMQGVTIGRAVDLSVLNGYDQLILELEKLFDIKGQLQTRNQWEIAFTDSDEDKMLVGDDPWPEFCNMVKKIFIQKRR 01DCBAB5889B2ECA iaa2_arath Auxin-responsive protein IAA2 Indoleacetic acid-induced protein 2 IAA2 At3g23030 MXC7.6 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAYEKVNELNLKDTELCLGLPGRTEKIKEEQEVSCVKSNNKRLFEETRDEEESTPPTKTQIVGWPPVRSSRKNNNSVSYVKVSMDGAPYLRKIDLKTYKNYPELLKALENMFKVMIGEYCEREGYKGSGFVPTYEDKDGDWMLVGDVPWDMFSSSCKRLRIMKGSDAPALDSSL DECA4F59F0106179 iaa18_arath Auxin-responsive protein IAA18 IAA18 Indoleacetic acid-induced protein 18 T14L22.14 At1g51950 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEGYSRNGEISPKLLDLMIPQERRNWFHDEKNSVFKTEEKKLELKLGPPGEEDDDESMIRHMKKEPKDKSILSLAGKYFSPSSTKTTSHKRTAPGPVVGWPPVRSFRKNLASGSSSKLGNDSTTSNGVTLKNQKCDAAAKTTEPKRQGGMFVKINMYGVPIGRKVDLSAHNSYEQLSFTVDKLFRGLLAAQRDFPSSIEDEKPITGLLDGNGEYTLTYEDNEGDKMLVGDVPWQMFVSSVKRLRVIKTSEISSALTYGNGKQEKMRR DIP protein O24408 original sequence version: 95 F1DC7E50172B7B10 iaa1_arath Auxin-responsive protein IAA1 Indoleacetic acid-induced protein 1 IAA1 At4g14560 dl3320w FCAALL.409 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEVTNGLNLKDTELRLGLPGAQEEQQLELSCVRSNNKRKNNDSTEESAPPPAKTQIVGWPPVRSNRKNNNNKNVSYVKVSMDGAPYLRKIDLKMYKNYPELLKALENMFKFTVGEYSEREGYKGSGFVPTYEDKDGDWMLVGDVPWDMFSSSCQKLRIMKGSEAPTAL DIP protein P49677 original sequence version: 105 17CA9B3BEB7962EE iaa27_arath Auxin-responsive protein IAA27 IAA27 PAP2 Auxin-induced protein 27 Indoleacetic acid-induced protein 27 Phytochrome-associated protein 2 F19B15.110 At4g29080 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSVSVAAEHDYIGLSEFPTMEATTMSDKTKTRDNNNGLNFKATELRLGLPGSESPERVDSRFLALNKSSCPVSGAKRVFSDAINDSNKWVFSPGSTTATGDVGSGSGPRTSVVKDGKSTTFTKPAVPVKEKKSSATAPASKAQVVGWPPIRSFRKNSMASSQSQKPGNNSETEEAEAKSGPEQPCLYVKVSMEGAPYLRKIDLKTYKSYLELSSALEKMFSCFTIGQFGSHGGCGRDGLNESRLTDLLRGSEYVVTYEDKDSDWMLVGDVPWEMFICSCKKLRIMKSSEAIGLAPRVMEKCRSRN 18F83E199FFC0A84 arf1-iaa31 1 IAA31 At3g17600 6 unspecified role unspecified role prey prey ARF1 At1g59750 42 unspecified role unspecified role bait bait physical association physical association Table S1 arf2-arf12 1 ARF12 At1g34310 50 unspecified role unspecified role prey prey ARF2 At5g62000 39 unspecified role unspecified role bait bait physical association physical association Table S1 arf2-iaa10 1 IAA10 At1g04100 8 unspecified role unspecified role prey prey ARF2 At5g62000 39 unspecified role unspecified role bait bait physical association physical association Table S1 arf2-iaa32 1 ARF2 At5g62000 39 unspecified role unspecified role bait bait IAA32 At2g01200 7 unspecified role unspecified role prey prey physical association physical association Table S1 arf2-iaa34 1 ARF2 At5g62000 39 unspecified role unspecified role bait bait IAA34 At1g15050 11 unspecified role unspecified role prey prey physical association physical association Table S1 arf3-iaa9 1 ARF3 At2g33860 12 unspecified role unspecified role bait bait IAA9 At5g65670 27 unspecified role unspecified role prey prey physical association physical association Table S1 arf4-iaa5 1 ARF4 At5g60450 30 unspecified role unspecified role bait bait IAA5 At1g15580 4 unspecified role unspecified role prey prey physical association physical association Table S1 arf4-iaa7 1 IAA7 At3g23050 36 unspecified role unspecified role prey prey ARF4 At5g60450 30 unspecified role unspecified role bait bait physical association physical association Table S1 arf4-iaa17 1 IAA17 At1g04250 26 unspecified role unspecified role prey prey ARF4 At5g60450 30 unspecified role unspecified role bait bait physical association physical association Table S1 arf4-iaa34 1 IAA34 At1g15050 11 unspecified role unspecified role prey prey ARF4 At5g60450 30 unspecified role unspecified role bait bait physical association physical association Table S1 arf5-iaa1 1 IAA1 At4g14560 53 unspecified role unspecified role prey prey ARF5 At1g19850 40 unspecified role unspecified role bait bait physical association physical association Table S1 arf5-iaa2 1 ARF5 At1g19850 40 unspecified role unspecified role bait bait IAA2 At3g23030 51 unspecified role unspecified role prey prey physical association physical association Table S1 arf5-iaa3 1 ARF5 At1g19850 40 unspecified role unspecified role bait bait IAA3 At1g04240 24 unspecified role unspecified role prey prey physical association physical association Table S1 arf5-iaa4 1 IAA4 At5g43700 19 unspecified role unspecified role prey prey ARF5 At1g19850 40 unspecified role unspecified role bait bait physical association physical association Table S1 arf5-iaa5 1 IAA5 At1g15580 4 unspecified role unspecified role prey prey ARF5 At1g19850 40 unspecified role unspecified role bait bait physical association physical association Table S1 arf5-iaa7 1 ARF5 At1g19850 40 unspecified role unspecified role bait bait IAA7 At3g23050 36 unspecified role unspecified role prey prey physical association physical association Table S1 arf5-iaa8 1 ARF5 At1g19850 40 unspecified role unspecified role bait bait IAA8 At2g22670 15 unspecified role unspecified role prey prey physical association physical association Table S1 arf5-iaa10 1 IAA10 At1g04100 8 unspecified role unspecified role prey prey ARF5 At1g19850 40 unspecified role unspecified role bait bait physical association physical association Table S1 arf5-iaa11 1 ARF5 At1g19850 40 unspecified role unspecified role bait bait IAA11 At4g28640 48 unspecified role unspecified role prey prey physical association physical association Table S1 arf5-iaa12 1 ARF5 At1g19850 40 unspecified role unspecified role bait bait IAA12 At1g04550 25 unspecified role unspecified role prey prey physical association physical association Table S1 arf5-iaa13 1 IAA13 At2g33310 5 unspecified role unspecified role prey prey ARF5 At1g19850 40 unspecified role unspecified role bait bait physical association physical association Table S1 arf5-iaa14 1 IAA14 At4g14550 13 unspecified role unspecified role prey prey ARF5 At1g19850 40 unspecified role unspecified role bait bait physical association physical association Table S1 arf5-iaa15 1 IAA15 At1g80390 45 unspecified role unspecified role prey prey ARF5 At1g19850 40 unspecified role unspecified role bait bait physical association physical association Table S1 arf5-iaa16 1 IAA16 At3g04730 49 unspecified role unspecified role prey prey ARF5 At1g19850 40 unspecified role unspecified role bait bait physical association physical association Table S1 arf5-iaa17 1 ARF5 At1g19850 40 unspecified role unspecified role bait bait IAA17 At1g04250 26 unspecified role unspecified role prey prey physical association physical association Table S1 arf5-iaa18 1 IAA18 At1g51950 52 unspecified role unspecified role prey prey ARF5 At1g19850 40 unspecified role unspecified role bait bait physical association physical association Table S1 arf5-iaa19 1 IAA19 At3g15540 16 unspecified role unspecified role prey prey ARF5 At1g19850 40 unspecified role unspecified role bait bait physical association physical association Table S1 arf5-iaa20 1 IAA20 At2g46990 47 unspecified role unspecified role prey prey ARF5 At1g19850 40 unspecified role unspecified role bait bait physical association physical association Table S1 arf5-iaa27 1 IAA27 At4g29080 54 unspecified role unspecified role prey prey ARF5 At1g19850 40 unspecified role unspecified role bait bait physical association physical association Table S1 arf5-iaa28 1 ARF5 At1g19850 40 unspecified role unspecified role bait bait IAA28 At5g25890 32 unspecified role unspecified role prey prey physical association physical association Table S1 arf5-iaa29 1 ARF5 At1g19850 40 unspecified role unspecified role bait bait IAA29 At4g32280 34 unspecified role unspecified role prey prey physical association physical association Table S1 arf5-iaa30 1 IAA30 At3g62100 41 unspecified role unspecified role prey prey ARF5 At1g19850 40 unspecified role unspecified role bait bait physical association physical association Table S1 arf5-iaa31 1 ARF5 At1g19850 40 unspecified role unspecified role bait bait IAA31 At3g17600 6 unspecified role unspecified role prey prey physical association physical association Table S1 arf5-iaa32 1 ARF5 At1g19850 40 unspecified role unspecified role bait bait IAA32 At2g01200 7 unspecified role unspecified role prey prey physical association physical association Table S1 arf5-iaa33 1 IAA33 At5g57420 33 unspecified role unspecified role prey prey ARF5 At1g19850 40 unspecified role unspecified role bait bait physical association physical association Table S1 arf5-iaa34 1 ARF5 At1g19850 40 unspecified role unspecified role bait bait IAA34 At1g15050 11 unspecified role unspecified role prey prey physical association physical association Table S1 arf6-arf9 1 ARF9 At4g23980 21 unspecified role unspecified role prey prey ARF6 At1g30330 43 unspecified role unspecified role bait bait physical association physical association Table S1 arf6-arf18 1 ARF6 At1g30330 43 unspecified role unspecified role bait bait ARF18 At3g61830 46 unspecified role unspecified role prey prey physical association physical association Table S1 arf6-iaa1 1 ARF6 At1g30330 43 unspecified role unspecified role bait bait IAA1 At4g14560 53 unspecified role unspecified role prey prey physical association physical association Table S1 arf6-iaa2 1 IAA2 At3g23030 51 unspecified role unspecified role prey prey ARF6 At1g30330 43 unspecified role unspecified role bait bait physical association physical association Table S1 arf6-iaa3 1 ARF6 At1g30330 43 unspecified role unspecified role bait bait IAA3 At1g04240 24 unspecified role unspecified role prey prey physical association physical association Table S1 arf6-iaa4 1 IAA4 At5g43700 19 unspecified role unspecified role prey prey ARF6 At1g30330 43 unspecified role unspecified role bait bait physical association physical association Table S1 arf6-iaa7 1 ARF6 At1g30330 43 unspecified role unspecified role bait bait IAA7 At3g23050 36 unspecified role unspecified role prey prey physical association physical association Table S1 arf6-iaa8 1 ARF6 At1g30330 43 unspecified role unspecified role bait bait IAA8 At2g22670 15 unspecified role unspecified role prey prey physical association physical association Table S1 arf6-iaa9 1 IAA9 At5g65670 27 unspecified role unspecified role prey prey ARF6 At1g30330 43 unspecified role unspecified role bait bait physical association physical association Table S1 arf6-iaa10 1 ARF6 At1g30330 43 unspecified role unspecified role bait bait IAA10 At1g04100 8 unspecified role unspecified role prey prey physical association physical association Table S1 arf6-iaa11 1 ARF6 At1g30330 43 unspecified role unspecified role bait bait IAA11 At4g28640 48 unspecified role unspecified role prey prey physical association physical association Table S1 arf6-iaa13 1 IAA13 At2g33310 5 unspecified role unspecified role prey prey ARF6 At1g30330 43 unspecified role unspecified role bait bait physical association physical association Table S1 arf6-iaa15 1 ARF6 At1g30330 43 unspecified role unspecified role bait bait IAA15 At1g80390 45 unspecified role unspecified role prey prey physical association physical association Table S1 arf6-iaa16 1 ARF6 At1g30330 43 unspecified role unspecified role bait bait IAA16 At3g04730 49 unspecified role unspecified role prey prey physical association physical association Table S1 arf6-iaa17 1 ARF6 At1g30330 43 unspecified role unspecified role bait bait IAA17 At1g04250 26 unspecified role unspecified role prey prey physical association physical association Table S1 arf6-iaa18 1 IAA18 At1g51950 52 unspecified role unspecified role prey prey ARF6 At1g30330 43 unspecified role unspecified role bait bait physical association physical association Table S1 arf6-iaa20 1 ARF6 At1g30330 43 unspecified role unspecified role bait bait IAA20 At2g46990 47 unspecified role unspecified role prey prey physical association physical association Table S1 arf6-iaa27 1 IAA27 At4g29080 54 unspecified role unspecified role prey prey ARF6 At1g30330 43 unspecified role unspecified role bait bait physical association physical association Table S1 arf6-iaa28 1 ARF6 At1g30330 43 unspecified role unspecified role bait bait IAA28 At5g25890 32 unspecified role unspecified role prey prey physical association physical association Table S1 arf6-iaa29 1 ARF6 At1g30330 43 unspecified role unspecified role bait bait IAA29 At4g32280 34 unspecified role unspecified role prey prey physical association physical association Table S1 arf6-iaa30 1 IAA30 At3g62100 41 unspecified role unspecified role prey prey ARF6 At1g30330 43 unspecified role unspecified role bait bait physical association physical association Table S1 arf6-iaa31 1 ARF6 At1g30330 43 unspecified role unspecified role bait bait IAA31 At3g17600 6 unspecified role unspecified role prey prey physical association physical association Table S1 arf6-iaa32 1 IAA32 At2g01200 7 unspecified role unspecified role prey prey ARF6 At1g30330 43 unspecified role unspecified role bait bait physical association physical association Table S1 arf6-iaa33 1 ARF6 At1g30330 43 unspecified role unspecified role bait bait IAA33 At5g57420 33 unspecified role unspecified role prey prey physical association physical association Table S1 arf6-iaa34 1 ARF6 At1g30330 43 unspecified role unspecified role bait bait IAA34 At1g15050 11 unspecified role unspecified role prey prey physical association physical association Table S1 arf7-arf20 1 ARF20 At1g35240 23 unspecified role unspecified role prey prey ARF7 At5g20730 10 unspecified role unspecified role bait bait physical association physical association Table S1 arf7-iaa1 1 ARF7 At5g20730 10 unspecified role unspecified role bait bait IAA1 At4g14560 53 unspecified role unspecified role prey prey physical association physical association Table S1 arf7-iaa2 1 ARF7 At5g20730 10 unspecified role unspecified role bait bait IAA2 At3g23030 51 unspecified role unspecified role prey prey physical association physical association Table S1 arf7-iaa3 1 ARF7 At5g20730 10 unspecified role unspecified role bait bait IAA3 At1g04240 24 unspecified role unspecified role prey prey physical association physical association Table S1 arf7-iaa4 1 IAA4 At5g43700 19 unspecified role unspecified role prey prey ARF7 At5g20730 10 unspecified role unspecified role bait bait physical association physical association Table S1 arf7-iaa7 1 ARF7 At5g20730 10 unspecified role unspecified role bait bait IAA7 At3g23050 36 unspecified role unspecified role prey prey physical association physical association Table S1 arf7-iaa8 1 IAA8 At2g22670 15 unspecified role unspecified role prey prey ARF7 At5g20730 10 unspecified role unspecified role bait bait physical association physical association Table S1 arf7-iaa10 1 IAA10 At1g04100 8 unspecified role unspecified role prey prey ARF7 At5g20730 10 unspecified role unspecified role bait bait physical association physical association Table S1 arf7-iaa11 1 ARF7 At5g20730 10 unspecified role unspecified role bait bait IAA11 At4g28640 48 unspecified role unspecified role prey prey physical association physical association Table S1 arf7-iaa12 1 IAA12 At1g04550 25 unspecified role unspecified role prey prey ARF7 At5g20730 10 unspecified role unspecified role bait bait physical association physical association Table S1 arf7-iaa13 1 IAA13 At2g33310 5 unspecified role unspecified role prey prey ARF7 At5g20730 10 unspecified role unspecified role bait bait physical association physical association Table S1 arf7-iaa14 1 IAA14 At4g14550 13 unspecified role unspecified role prey prey ARF7 At5g20730 10 unspecified role unspecified role bait bait physical association physical association Table S1 arf7-iaa15 1 IAA15 At1g80390 45 unspecified role unspecified role prey prey ARF7 At5g20730 10 unspecified role unspecified role bait bait physical association physical association Table S1 arf7-iaa16 1 IAA16 At3g04730 49 unspecified role unspecified role prey prey ARF7 At5g20730 10 unspecified role unspecified role bait bait physical association physical association Table S1 arf7-iaa17 1 ARF7 At5g20730 10 unspecified role unspecified role bait bait IAA17 At1g04250 26 unspecified role unspecified role prey prey physical association physical association Table S1 arf7-iaa18 1 IAA18 At1g51950 52 unspecified role unspecified role prey prey ARF7 At5g20730 10 unspecified role unspecified role bait bait physical association physical association Table S1 arf7-iaa19 1 ARF7 At5g20730 10 unspecified role unspecified role bait bait IAA19 At3g15540 16 unspecified role unspecified role prey prey physical association physical association Table S1 arf7-iaa20 1 IAA20 At2g46990 47 unspecified role unspecified role prey prey ARF7 At5g20730 10 unspecified role unspecified role bait bait physical association physical association Table S1 arf7-iaa27 1 ARF7 At5g20730 10 unspecified role unspecified role bait bait IAA27 At4g29080 54 unspecified role unspecified role prey prey physical association physical association Table S1 arf7-iaa28 1 IAA28 At5g25890 32 unspecified role unspecified role prey prey ARF7 At5g20730 10 unspecified role unspecified role bait bait physical association physical association Table S1 arf7-iaa29 1 IAA29 At4g32280 34 unspecified role unspecified role prey prey ARF7 At5g20730 10 unspecified role unspecified role bait bait physical association physical association Table S1 arf7-iaa32 1 IAA32 At2g01200 7 unspecified role unspecified role prey prey ARF7 At5g20730 10 unspecified role unspecified role bait bait physical association physical association Table S1 arf8-iaa1 1 ARF8 At5g37020 44 unspecified role unspecified role bait bait IAA1 At4g14560 53 unspecified role unspecified role prey prey physical association physical association Table S1 arf8-iaa2 1 ARF8 At5g37020 44 unspecified role unspecified role bait bait IAA2 At3g23030 51 unspecified role unspecified role prey prey physical association physical association Table S1 arf8-iaa3 1 ARF8 At5g37020 44 unspecified role unspecified role bait bait IAA3 At1g04240 24 unspecified role unspecified role prey prey physical association physical association Table S1 arf8-iaa4 1 ARF8 At5g37020 44 unspecified role unspecified role bait bait IAA4 At5g43700 19 unspecified role unspecified role prey prey physical association physical association Table S1 arf8-iaa7 1 ARF8 At5g37020 44 unspecified role unspecified role bait bait IAA7 At3g23050 36 unspecified role unspecified role prey prey physical association physical association Table S1 arf8-iaa8 1 ARF8 At5g37020 44 unspecified role unspecified role bait bait IAA8 At2g22670 15 unspecified role unspecified role prey prey physical association physical association Table S1 arf8-iaa10 1 ARF8 At5g37020 44 unspecified role unspecified role bait bait IAA10 At1g04100 8 unspecified role unspecified role prey prey physical association physical association Table S1 arf8-iaa12 1 ARF8 At5g37020 44 unspecified role unspecified role bait bait IAA12 At1g04550 25 unspecified role unspecified role prey prey physical association physical association Table S1 arf8-iaa13 1 IAA13 At2g33310 5 unspecified role unspecified role prey prey ARF8 At5g37020 44 unspecified role unspecified role bait bait physical association physical association Table S1 arf8-iaa15 1 ARF8 At5g37020 44 unspecified role unspecified role bait bait IAA15 At1g80390 45 unspecified role unspecified role prey prey physical association physical association Table S1 arf8-iaa16 1 IAA16 At3g04730 49 unspecified role unspecified role prey prey ARF8 At5g37020 44 unspecified role unspecified role bait bait physical association physical association Table S1 arf8-iaa17 1 ARF8 At5g37020 44 unspecified role unspecified role bait bait IAA17 At1g04250 26 unspecified role unspecified role prey prey physical association physical association Table S1 arf8-iaa18 1 IAA18 At1g51950 52 unspecified role unspecified role prey prey ARF8 At5g37020 44 unspecified role unspecified role bait bait physical association physical association Table S1 arf8-iaa19 1 ARF8 At5g37020 44 unspecified role unspecified role bait bait IAA19 At3g15540 16 unspecified role unspecified role prey prey physical association physical association Table S1 arf8-iaa20 1 IAA20 At2g46990 47 unspecified role unspecified role prey prey ARF8 At5g37020 44 unspecified role unspecified role bait bait physical association physical association Table S1 arf8-iaa27 1 IAA27 At4g29080 54 unspecified role unspecified role prey prey ARF8 At5g37020 44 unspecified role unspecified role bait bait physical association physical association Table S1 arf8-iaa28 1 IAA28 At5g25890 32 unspecified role unspecified role prey prey ARF8 At5g37020 44 unspecified role unspecified role bait bait physical association physical association Table S1 arf8-iaa29 1 ARF8 At5g37020 44 unspecified role unspecified role bait bait IAA29 At4g32280 34 unspecified role unspecified role prey prey physical association physical association Table S1 arf8-iaa30 1 ARF8 At5g37020 44 unspecified role unspecified role bait bait IAA30 At3g62100 41 unspecified role unspecified role prey prey physical association physical association Table S1 arf8-iaa31 1 IAA31 At3g17600 6 unspecified role unspecified role prey prey ARF8 At5g37020 44 unspecified role unspecified role bait bait physical association physical association Table S1 arf8-iaa32 1 ARF8 At5g37020 44 unspecified role unspecified role bait bait IAA32 At2g01200 7 unspecified role unspecified role prey prey physical association physical association Table S1 arf9-arf20 1 ARF9 At4g23980 21 unspecified role unspecified role bait bait ARF20 At1g35240 23 unspecified role unspecified role prey prey physical association physical association Table S1 arf9-iaa1 1 IAA1 At4g14560 53 unspecified role unspecified role prey prey ARF9 At4g23980 21 unspecified role unspecified role bait bait physical association physical association Table S1 arf9-iaa2 1 ARF9 At4g23980 21 unspecified role unspecified role bait bait IAA2 At3g23030 51 unspecified role unspecified role prey prey physical association physical association Table S1 arf9-iaa3 1 IAA3 At1g04240 24 unspecified role unspecified role prey prey ARF9 At4g23980 21 unspecified role unspecified role bait bait physical association physical association Table S1 arf9-iaa4 1 ARF9 At4g23980 21 unspecified role unspecified role bait bait IAA4 At5g43700 19 unspecified role unspecified role prey prey physical association physical association Table S1 arf9-iaa10 1 ARF9 At4g23980 21 unspecified role unspecified role bait bait IAA10 At1g04100 8 unspecified role unspecified role prey prey physical association physical association Table S1 arf9-iaa12 1 IAA12 At1g04550 25 unspecified role unspecified role prey prey ARF9 At4g23980 21 unspecified role unspecified role bait bait physical association physical association Table S1 arf9-iaa13 1 ARF9 At4g23980 21 unspecified role unspecified role bait bait IAA13 At2g33310 5 unspecified role unspecified role prey prey physical association physical association Table S1 arf9-iaa16 1 IAA16 At3g04730 49 unspecified role unspecified role prey prey ARF9 At4g23980 21 unspecified role unspecified role bait bait physical association physical association Table S1 arf9-iaa17 1 IAA17 At1g04250 26 unspecified role unspecified role prey prey ARF9 At4g23980 21 unspecified role unspecified role bait bait physical association physical association Table S1 arf9-iaa18 1 IAA18 At1g51950 52 unspecified role unspecified role prey prey ARF9 At4g23980 21 unspecified role unspecified role bait bait physical association physical association Table S1 arf9-iaa26 1 ARF9 At4g23980 21 unspecified role unspecified role bait bait IAA26 At3g16500 14 unspecified role unspecified role prey prey physical association physical association Table S1 arf9-iaa27 1 ARF9 At4g23980 21 unspecified role unspecified role bait bait IAA27 At4g29080 54 unspecified role unspecified role prey prey physical association physical association Table S1 arf9-iaa28 1 ARF9 At4g23980 21 unspecified role unspecified role bait bait IAA28 At5g25890 32 unspecified role unspecified role prey prey physical association physical association Table S1 arf9-iaa29 1 ARF9 At4g23980 21 unspecified role unspecified role bait bait IAA29 At4g32280 34 unspecified role unspecified role prey prey physical association physical association Table S1 arf9-iaa30 1 ARF9 At4g23980 21 unspecified role unspecified role bait bait IAA30 At3g62100 41 unspecified role unspecified role prey prey physical association physical association Table S1 arf9-iaa32 1 ARF9 At4g23980 21 unspecified role unspecified role bait bait IAA32 At2g01200 7 unspecified role unspecified role prey prey physical association physical association Table S1 arf9-iaa34 1 ARF9 At4g23980 21 unspecified role unspecified role bait bait IAA34 At1g15050 11 unspecified role unspecified role prey prey physical association physical association Table S1 arf10-iaa5 1 ARF10 At2g28350 20 unspecified role unspecified role bait bait IAA5 At1g15580 4 unspecified role unspecified role prey prey physical association physical association Table S1 arf10-iaa17 1 IAA17 At1g04250 26 unspecified role unspecified role prey prey ARF10 At2g28350 20 unspecified role unspecified role bait bait physical association physical association Table S1 arf10-iaa26 1 ARF10 At2g28350 20 unspecified role unspecified role bait bait IAA26 At3g16500 14 unspecified role unspecified role prey prey physical association physical association Table S1 arf10-iaa32 1 IAA32 At2g01200 7 unspecified role unspecified role prey prey ARF10 At2g28350 20 unspecified role unspecified role bait bait physical association physical association Table S1 arf10-iaa33 1 IAA33 At5g57420 33 unspecified role unspecified role prey prey ARF10 At2g28350 20 unspecified role unspecified role bait bait physical association physical association Table S1 arf12-arf22 1 ARF22 At1g34390 31 unspecified role unspecified role prey prey ARF12 At1g34310 50 unspecified role unspecified role bait bait physical association physical association Table S1 arf12-iaa30 1 IAA30 At3g62100 41 unspecified role unspecified role prey prey ARF12 At1g34310 50 unspecified role unspecified role bait bait physical association physical association Table S1 arf12-iaa31 1 ARF12 At1g34310 50 unspecified role unspecified role bait bait IAA31 At3g17600 6 unspecified role unspecified role prey prey physical association physical association Table S1 arf13-iaa4 1 ARF13 At1g34170 37 unspecified role unspecified role bait bait IAA4 At5g43700 19 unspecified role unspecified role prey prey physical association physical association Table S1 arf14-iaa5 1 ARF14 At1g35540 22 unspecified role unspecified role bait bait IAA5 At1g15580 4 unspecified role unspecified role prey prey physical association physical association Table S1 arf16-iaa5 1 IAA5 At1g15580 4 unspecified role unspecified role prey prey ARF16 At4g30080 9 unspecified role unspecified role bait bait physical association physical association Table S1 arf16-iaa26 1 IAA26 At3g16500 14 unspecified role unspecified role prey prey ARF16 At4g30080 9 unspecified role unspecified role bait bait physical association physical association Table S1 arf16-iaa32 1 IAA32 At2g01200 7 unspecified role unspecified role prey prey ARF16 At4g30080 9 unspecified role unspecified role bait bait physical association physical association Table S1 arf16-iaa33 1 IAA33 At5g57420 33 unspecified role unspecified role prey prey ARF16 At4g30080 9 unspecified role unspecified role bait bait physical association physical association Table S1 arf17-iaa1 1 IAA1 At4g14560 53 unspecified role unspecified role prey prey ARF17 At1g77850 35 unspecified role unspecified role bait bait physical association physical association Table S1 arf17-iaa29 1 IAA29 At4g32280 34 unspecified role unspecified role prey prey ARF17 At1g77850 35 unspecified role unspecified role bait bait physical association physical association Table S1 arf17-iaa32 1 IAA32 At2g01200 7 unspecified role unspecified role prey prey ARF17 At1g77850 35 unspecified role unspecified role bait bait physical association physical association Table S1 arf18-iaa32 1 IAA32 At2g01200 7 unspecified role unspecified role prey prey ARF18 At3g61830 46 unspecified role unspecified role bait bait physical association physical association Table S1 arf18-iaa33 1 ARF18 At3g61830 46 unspecified role unspecified role bait bait IAA33 At5g57420 33 unspecified role unspecified role prey prey physical association physical association Table S1 arf18-iaa34 1 IAA34 At1g15050 11 unspecified role unspecified role prey prey ARF18 At3g61830 46 unspecified role unspecified role bait bait physical association physical association Table S1 arf19-arf20 1 ARF19 At1g19220 28 unspecified role unspecified role bait bait ARF20 At1g35240 23 unspecified role unspecified role prey prey physical association physical association Table S1 arf19-iaa1 1 ARF19 At1g19220 28 unspecified role unspecified role bait bait IAA1 At4g14560 53 unspecified role unspecified role prey prey physical association physical association Table S1 arf19-iaa2 1 IAA2 At3g23030 51 unspecified role unspecified role prey prey ARF19 At1g19220 28 unspecified role unspecified role bait bait physical association physical association Table S1 arf19-iaa3 1 ARF19 At1g19220 28 unspecified role unspecified role bait bait IAA3 At1g04240 24 unspecified role unspecified role prey prey physical association physical association Table S1 arf19-iaa4 1 IAA4 At5g43700 19 unspecified role unspecified role prey prey ARF19 At1g19220 28 unspecified role unspecified role bait bait physical association physical association Table S1 arf19-iaa5 1 IAA5 At1g15580 4 unspecified role unspecified role prey prey ARF19 At1g19220 28 unspecified role unspecified role bait bait physical association physical association Table S1 arf19-iaa7 1 ARF19 At1g19220 28 unspecified role unspecified role bait bait IAA7 At3g23050 36 unspecified role unspecified role prey prey physical association physical association Table S1 arf19-iaa8 1 IAA8 At2g22670 15 unspecified role unspecified role prey prey ARF19 At1g19220 28 unspecified role unspecified role bait bait physical association physical association Table S1 arf19-iaa10 1 ARF19 At1g19220 28 unspecified role unspecified role bait bait IAA10 At1g04100 8 unspecified role unspecified role prey prey physical association physical association Table S1 arf19-iaa12 1 ARF19 At1g19220 28 unspecified role unspecified role bait bait IAA12 At1g04550 25 unspecified role unspecified role prey prey physical association physical association Table S1 arf19-iaa13 1 ARF19 At1g19220 28 unspecified role unspecified role bait bait IAA13 At2g33310 5 unspecified role unspecified role prey prey physical association physical association Table S1 arf19-iaa14 1 IAA14 At4g14550 13 unspecified role unspecified role prey prey ARF19 At1g19220 28 unspecified role unspecified role bait bait physical association physical association Table S1 arf19-iaa15 1 IAA15 At1g80390 45 unspecified role unspecified role prey prey ARF19 At1g19220 28 unspecified role unspecified role bait bait physical association physical association Table S1 arf19-iaa16 1 ARF19 At1g19220 28 unspecified role unspecified role bait bait IAA16 At3g04730 49 unspecified role unspecified role prey prey physical association physical association Table S1 arf19-iaa17 1 ARF19 At1g19220 28 unspecified role unspecified role bait bait IAA17 At1g04250 26 unspecified role unspecified role prey prey physical association physical association Table S1 arf19-iaa18 1 IAA18 At1g51950 52 unspecified role unspecified role prey prey ARF19 At1g19220 28 unspecified role unspecified role bait bait physical association physical association Table S1 arf19-iaa19 1 IAA19 At3g15540 16 unspecified role unspecified role prey prey ARF19 At1g19220 28 unspecified role unspecified role bait bait physical association physical association Table S1 arf19-iaa20 1 ARF19 At1g19220 28 unspecified role unspecified role bait bait IAA20 At2g46990 47 unspecified role unspecified role prey prey physical association physical association Table S1 arf19-iaa28 1 IAA28 At5g25890 32 unspecified role unspecified role prey prey ARF19 At1g19220 28 unspecified role unspecified role bait bait physical association physical association Table S1 arf19-iaa29 1 IAA29 At4g32280 34 unspecified role unspecified role prey prey ARF19 At1g19220 28 unspecified role unspecified role bait bait physical association physical association Table S1 arf19-iaa30 1 IAA30 At3g62100 41 unspecified role unspecified role prey prey ARF19 At1g19220 28 unspecified role unspecified role bait bait physical association physical association Table S1 arf19-iaa32 1 IAA32 At2g01200 7 unspecified role unspecified role prey prey ARF19 At1g19220 28 unspecified role unspecified role bait bait physical association physical association Table S1 arf19-iaa33 1 ARF19 At1g19220 28 unspecified role unspecified role bait bait IAA33 At5g57420 33 unspecified role unspecified role prey prey physical association physical association Table S1 arf19-iaa34 1 ARF19 At1g19220 28 unspecified role unspecified role bait bait IAA34 At1g15050 11 unspecified role unspecified role prey prey physical association physical association Table S1 arf20-iaa5 1 ARF20 At1g35240 23 unspecified role unspecified role bait bait IAA5 At1g15580 4 unspecified role unspecified role prey prey physical association physical association Table S1 arf20-iaa15 1 IAA15 At1g80390 45 unspecified role unspecified role prey prey ARF20 At1g35240 23 unspecified role unspecified role bait bait physical association physical association Table S1 arf20-iaa17 1 ARF20 At1g35240 23 unspecified role unspecified role bait bait IAA17 At1g04250 26 unspecified role unspecified role prey prey physical association physical association Table S1 arf20-iaa31 1 IAA31 At3g17600 6 unspecified role unspecified role prey prey ARF20 At1g35240 23 unspecified role unspecified role bait bait physical association physical association Table S1 arf20-iaa33 1 IAA33 At5g57420 33 unspecified role unspecified role prey prey ARF20 At1g35240 23 unspecified role unspecified role bait bait physical association physical association Table S1 arf22-iaa5 1 IAA5 At1g15580 4 unspecified role unspecified role prey prey ARF22 At1g34390 31 unspecified role unspecified role bait bait physical association physical association Table S1 arf22-iaa7 1 ARF22 At1g34390 31 unspecified role unspecified role bait bait IAA7 At3g23050 36 unspecified role unspecified role prey prey physical association physical association Table S1 arf22-iaa9 1 IAA9 At5g65670 27 unspecified role unspecified role prey prey ARF22 At1g34390 31 unspecified role unspecified role bait bait physical association physical association Table S1 arf22-iaa16 1 ARF22 At1g34390 31 unspecified role unspecified role bait bait IAA16 At3g04730 49 unspecified role unspecified role prey prey physical association physical association Table S1 arf22-iaa20 1 ARF22 At1g34390 31 unspecified role unspecified role bait bait IAA20 At2g46990 47 unspecified role unspecified role prey prey physical association physical association Table S1 arf22-iaa27 1 IAA27 At4g29080 54 unspecified role unspecified role prey prey ARF22 At1g34390 31 unspecified role unspecified role bait bait physical association physical association Table S1 arf22-iaa28 1 ARF22 At1g34390 31 unspecified role unspecified role bait bait IAA28 At5g25890 32 unspecified role unspecified role prey prey physical association physical association Table S1 arf22-iaa32 1 IAA32 At2g01200 7 unspecified role unspecified role prey prey ARF22 At1g34390 31 unspecified role unspecified role bait bait physical association physical association Table S1 arf22-iaa34 1 IAA34 At1g15050 11 unspecified role unspecified role prey prey ARF22 At1g34390 31 unspecified role unspecified role bait bait physical association physical association Table S1 iaa1-iaa1 1 IAA1 At4g14560 53 unspecified role unspecified role prey prey IAA1 At4g14560 53 unspecified role unspecified role bait bait physical association physical association Table S1 iaa1-iaa2 1 IAA2 At3g23030 51 unspecified role unspecified role prey prey IAA1 At4g14560 53 unspecified role unspecified role bait bait physical association physical association Table S1 iaa1-iaa3 1 IAA1 At4g14560 53 unspecified role unspecified role bait bait IAA3 At1g04240 24 unspecified role unspecified role prey prey physical association physical association Table S1 iaa1-iaa4 1 IAA1 At4g14560 53 unspecified role unspecified role bait bait IAA4 At5g43700 19 unspecified role unspecified role prey prey physical association physical association Table S1 iaa1-iaa5 1 IAA1 At4g14560 53 unspecified role unspecified role bait bait IAA5 At1g15580 4 unspecified role unspecified role prey prey physical association physical association Table S1 iaa1-iaa7 1 IAA1 At4g14560 53 unspecified role unspecified role bait bait IAA7 At3g23050 36 unspecified role unspecified role prey prey physical association physical association Table S1 iaa1-iaa8 1 IAA1 At4g14560 53 unspecified role unspecified role bait bait IAA8 At2g22670 15 unspecified role unspecified role prey prey physical association physical association Table S1 iaa1-iaa9 1 IAA9 At5g65670 27 unspecified role unspecified role prey prey IAA1 At4g14560 53 unspecified role unspecified role bait bait physical association physical association Table S1 iaa1-iaa14 1 IAA14 At4g14550 13 unspecified role unspecified role prey prey IAA1 At4g14560 53 unspecified role unspecified role bait bait physical association physical association Table S1 iaa1-iaa15 1 IAA15 At1g80390 45 unspecified role unspecified role prey prey IAA1 At4g14560 53 unspecified role unspecified role bait bait physical association physical association Table S1 iaa1-iaa16 1 IAA1 At4g14560 53 unspecified role unspecified role bait bait IAA16 At3g04730 49 unspecified role unspecified role prey prey physical association physical association Table S1 iaa1-iaa17 1 IAA1 At4g14560 53 unspecified role unspecified role bait bait IAA17 At1g04250 26 unspecified role unspecified role prey prey physical association physical association Table S1 iaa1-iaa18 1 IAA18 At1g51950 52 unspecified role unspecified role prey prey IAA1 At4g14560 53 unspecified role unspecified role bait bait physical association physical association Table S1 iaa1-iaa19 1 IAA1 At4g14560 53 unspecified role unspecified role bait bait IAA19 At3g15540 16 unspecified role unspecified role prey prey physical association physical association Table S1 iaa1-iaa27 1 IAA27 At4g29080 54 unspecified role unspecified role prey prey IAA1 At4g14560 53 unspecified role unspecified role bait bait physical association physical association Table S1 iaa1-iaa28 1 IAA28 At5g25890 32 unspecified role unspecified role prey prey IAA1 At4g14560 53 unspecified role unspecified role bait bait physical association physical association Table S1 iaa1-iaa30 1 IAA30 At3g62100 41 unspecified role unspecified role prey prey IAA1 At4g14560 53 unspecified role unspecified role bait bait physical association physical association Table S1 iaa1-iaa31 1 IAA1 At4g14560 53 unspecified role unspecified role bait bait IAA31 At3g17600 6 unspecified role unspecified role prey prey physical association physical association Table S1 iaa1-iaa34 1 IAA34 At1g15050 11 unspecified role unspecified role prey prey IAA1 At4g14560 53 unspecified role unspecified role bait bait physical association physical association Table S1 iaa2-iaa2 1 IAA2 At3g23030 51 unspecified role unspecified role prey prey IAA2 At3g23030 51 unspecified role unspecified role bait bait physical association physical association Table S1 iaa2-iaa3 1 IAA3 At1g04240 24 unspecified role unspecified role prey prey IAA2 At3g23030 51 unspecified role unspecified role bait bait physical association physical association Table S1 iaa2-iaa4 1 IAA2 At3g23030 51 unspecified role unspecified role bait bait IAA4 At5g43700 19 unspecified role unspecified role prey prey physical association physical association Table S1 iaa2-iaa5 1 IAA2 At3g23030 51 unspecified role unspecified role bait bait IAA5 At1g15580 4 unspecified role unspecified role prey prey physical association physical association Table S1 iaa2-iaa8 1 IAA2 At3g23030 51 unspecified role unspecified role bait bait IAA8 At2g22670 15 unspecified role unspecified role prey prey physical association physical association Table S1 iaa2-iaa9 1 IAA2 At3g23030 51 unspecified role unspecified role bait bait IAA9 At5g65670 27 unspecified role unspecified role prey prey physical association physical association Table S1 iaa2-iaa10 1 IAA10 At1g04100 8 unspecified role unspecified role prey prey IAA2 At3g23030 51 unspecified role unspecified role bait bait physical association physical association Table S1 iaa2-iaa14 1 IAA14 At4g14550 13 unspecified role unspecified role prey prey IAA2 At3g23030 51 unspecified role unspecified role bait bait physical association physical association Table S1 iaa2-iaa15 1 IAA2 At3g23030 51 unspecified role unspecified role bait bait IAA15 At1g80390 45 unspecified role unspecified role prey prey physical association physical association Table S1 iaa2-iaa16 1 IAA2 At3g23030 51 unspecified role unspecified role bait bait IAA16 At3g04730 49 unspecified role unspecified role prey prey physical association physical association Table S1 iaa2-iaa17 1 IAA2 At3g23030 51 unspecified role unspecified role bait bait IAA17 At1g04250 26 unspecified role unspecified role prey prey physical association physical association Table S1 iaa2-iaa20 1 IAA20 At2g46990 47 unspecified role unspecified role prey prey IAA2 At3g23030 51 unspecified role unspecified role bait bait physical association physical association Table S1 iaa2-iaa27 1 IAA2 At3g23030 51 unspecified role unspecified role bait bait IAA27 At4g29080 54 unspecified role unspecified role prey prey physical association physical association Table S1 iaa2-iaa28 1 IAA2 At3g23030 51 unspecified role unspecified role bait bait IAA28 At5g25890 32 unspecified role unspecified role prey prey physical association physical association Table S1 iaa2-iaa30 1 IAA30 At3g62100 41 unspecified role unspecified role prey prey IAA2 At3g23030 51 unspecified role unspecified role bait bait physical association physical association Table S1 iaa2-iaa33 1 IAA2 At3g23030 51 unspecified role unspecified role bait bait IAA33 At5g57420 33 unspecified role unspecified role prey prey physical association physical association Table S1 iaa2-iaa34 1 IAA34 At1g15050 11 unspecified role unspecified role prey prey IAA2 At3g23030 51 unspecified role unspecified role bait bait physical association physical association Table S1 iaa3-iaa3 1 IAA3 At1g04240 24 unspecified role unspecified role bait bait IAA3 At1g04240 24 unspecified role unspecified role prey prey physical association physical association Table S1 iaa3-iaa4 1 IAA3 At1g04240 24 unspecified role unspecified role bait bait IAA4 At5g43700 19 unspecified role unspecified role prey prey physical association physical association Table S1 iaa3-iaa5 1 IAA3 At1g04240 24 unspecified role unspecified role bait bait IAA5 At1g15580 4 unspecified role unspecified role prey prey physical association physical association Table S1 iaa3-iaa8 1 IAA3 At1g04240 24 unspecified role unspecified role bait bait IAA8 At2g22670 15 unspecified role unspecified role prey prey physical association physical association Table S1 iaa3-iaa9 1 IAA9 At5g65670 27 unspecified role unspecified role prey prey IAA3 At1g04240 24 unspecified role unspecified role bait bait physical association physical association Table S1 iaa3-iaa12 1 IAA12 At1g04550 25 unspecified role unspecified role prey prey IAA3 At1g04240 24 unspecified role unspecified role bait bait physical association physical association Table S1 iaa3-iaa13 1 IAA13 At2g33310 5 unspecified role unspecified role prey prey IAA3 At1g04240 24 unspecified role unspecified role bait bait physical association physical association Table S1 iaa3-iaa14 1 IAA14 At4g14550 13 unspecified role unspecified role prey prey IAA3 At1g04240 24 unspecified role unspecified role bait bait physical association physical association Table S1 iaa3-iaa15 1 IAA15 At1g80390 45 unspecified role unspecified role prey prey IAA3 At1g04240 24 unspecified role unspecified role bait bait physical association physical association Table S1 iaa3-iaa16 1 IAA16 At3g04730 49 unspecified role unspecified role prey prey IAA3 At1g04240 24 unspecified role unspecified role bait bait physical association physical association Table S1 iaa3-iaa17 1 IAA3 At1g04240 24 unspecified role unspecified role bait bait IAA17 At1g04250 26 unspecified role unspecified role prey prey physical association physical association Table S1 iaa3-iaa18 1 IAA3 At1g04240 24 unspecified role unspecified role bait bait IAA18 At1g51950 52 unspecified role unspecified role prey prey physical association physical association Table S1 iaa3-iaa19 1 IAA3 At1g04240 24 unspecified role unspecified role bait bait IAA19 At3g15540 16 unspecified role unspecified role prey prey physical association physical association Table S1 iaa3-iaa20 1 IAA3 At1g04240 24 unspecified role unspecified role bait bait IAA20 At2g46990 47 unspecified role unspecified role prey prey physical association physical association Table S1 iaa3-iaa27 1 IAA3 At1g04240 24 unspecified role unspecified role bait bait IAA27 At4g29080 54 unspecified role unspecified role prey prey physical association physical association Table S1 iaa3-iaa28 1 IAA28 At5g25890 32 unspecified role unspecified role prey prey IAA3 At1g04240 24 unspecified role unspecified role bait bait physical association physical association Table S1 iaa3-iaa30 1 IAA30 At3g62100 41 unspecified role unspecified role prey prey IAA3 At1g04240 24 unspecified role unspecified role bait bait physical association physical association Table S1 iaa3-iaa31 1 IAA31 At3g17600 6 unspecified role unspecified role prey prey IAA3 At1g04240 24 unspecified role unspecified role bait bait physical association physical association Table S1 iaa3-iaa34 1 IAA3 At1g04240 24 unspecified role unspecified role bait bait IAA34 At1g15050 11 unspecified role unspecified role prey prey physical association physical association Table S1 iaa4-iaa4 1 IAA4 At5g43700 19 unspecified role unspecified role bait bait IAA4 At5g43700 19 unspecified role unspecified role prey prey physical association physical association Table S1 iaa4-iaa5 1 IAA5 At1g15580 4 unspecified role unspecified role prey prey IAA4 At5g43700 19 unspecified role unspecified role bait bait physical association physical association Table S1 iaa4-iaa8 1 IAA4 At5g43700 19 unspecified role unspecified role bait bait IAA8 At2g22670 15 unspecified role unspecified role prey prey physical association physical association Table S1 iaa4-iaa9 1 IAA4 At5g43700 19 unspecified role unspecified role bait bait IAA9 At5g65670 27 unspecified role unspecified role prey prey physical association physical association Table S1 iaa4-iaa10 1 IAA4 At5g43700 19 unspecified role unspecified role bait bait IAA10 At1g04100 8 unspecified role unspecified role prey prey physical association physical association Table S1 iaa4-iaa11 1 IAA4 At5g43700 19 unspecified role unspecified role bait bait IAA11 At4g28640 48 unspecified role unspecified role prey prey physical association physical association Table S1 iaa4-iaa12 1 IAA4 At5g43700 19 unspecified role unspecified role bait bait IAA12 At1g04550 25 unspecified role unspecified role prey prey physical association physical association Table S1 iaa4-iaa13 1 IAA4 At5g43700 19 unspecified role unspecified role bait bait IAA13 At2g33310 5 unspecified role unspecified role prey prey physical association physical association Table S1 iaa4-iaa14 1 IAA4 At5g43700 19 unspecified role unspecified role bait bait IAA14 At4g14550 13 unspecified role unspecified role prey prey physical association physical association Table S1 iaa4-iaa15 1 IAA15 At1g80390 45 unspecified role unspecified role prey prey IAA4 At5g43700 19 unspecified role unspecified role bait bait physical association physical association Table S1 iaa4-iaa16 1 IAA4 At5g43700 19 unspecified role unspecified role bait bait IAA16 At3g04730 49 unspecified role unspecified role prey prey physical association physical association Table S1 iaa4-iaa17 1 IAA17 At1g04250 26 unspecified role unspecified role prey prey IAA4 At5g43700 19 unspecified role unspecified role bait bait physical association physical association Table S1 iaa4-iaa18 1 IAA4 At5g43700 19 unspecified role unspecified role bait bait IAA18 At1g51950 52 unspecified role unspecified role prey prey physical association physical association Table S1 iaa4-iaa19 1 IAA4 At5g43700 19 unspecified role unspecified role bait bait IAA19 At3g15540 16 unspecified role unspecified role prey prey physical association physical association Table S1 iaa4-iaa20 1 IAA4 At5g43700 19 unspecified role unspecified role bait bait IAA20 At2g46990 47 unspecified role unspecified role prey prey physical association physical association Table S1 iaa4-iaa27 1 IAA27 At4g29080 54 unspecified role unspecified role prey prey IAA4 At5g43700 19 unspecified role unspecified role bait bait physical association physical association Table S1 iaa4-iaa28 1 IAA4 At5g43700 19 unspecified role unspecified role bait bait IAA28 At5g25890 32 unspecified role unspecified role prey prey physical association physical association Table S1 iaa4-iaa30 1 IAA30 At3g62100 41 unspecified role unspecified role prey prey IAA4 At5g43700 19 unspecified role unspecified role bait bait physical association physical association Table S1 iaa4-iaa34 1 IAA34 At1g15050 11 unspecified role unspecified role prey prey IAA4 At5g43700 19 unspecified role unspecified role bait bait physical association physical association Table S1 iaa5-iaa5 1 IAA5 At1g15580 4 unspecified role unspecified role bait bait IAA5 At1g15580 4 unspecified role unspecified role prey prey physical association physical association Table S1 iaa5-iaa7 1 IAA5 At1g15580 4 unspecified role unspecified role bait bait IAA7 At3g23050 36 unspecified role unspecified role prey prey physical association physical association Table S1 iaa5-iaa8 1 IAA8 At2g22670 15 unspecified role unspecified role prey prey IAA5 At1g15580 4 unspecified role unspecified role bait bait physical association physical association Table S1 iaa5-iaa9 1 IAA9 At5g65670 27 unspecified role unspecified role prey prey IAA5 At1g15580 4 unspecified role unspecified role bait bait physical association physical association Table S1 iaa5-iaa10 1 IAA10 At1g04100 8 unspecified role unspecified role prey prey IAA5 At1g15580 4 unspecified role unspecified role bait bait physical association physical association Table S1 iaa5-iaa12 1 IAA5 At1g15580 4 unspecified role unspecified role bait bait IAA12 At1g04550 25 unspecified role unspecified role prey prey physical association physical association Table S1 iaa5-iaa13 1 IAA5 At1g15580 4 unspecified role unspecified role bait bait IAA13 At2g33310 5 unspecified role unspecified role prey prey physical association physical association Table S1 iaa5-iaa14 1 IAA5 At1g15580 4 unspecified role unspecified role bait bait IAA14 At4g14550 13 unspecified role unspecified role prey prey physical association physical association Table S1 iaa5-iaa15 1 IAA15 At1g80390 45 unspecified role unspecified role prey prey IAA5 At1g15580 4 unspecified role unspecified role bait bait physical association physical association Table S1 iaa5-iaa16 1 IAA5 At1g15580 4 unspecified role unspecified role bait bait IAA16 At3g04730 49 unspecified role unspecified role prey prey physical association physical association Table S1 iaa5-iaa17 1 IAA5 At1g15580 4 unspecified role unspecified role bait bait IAA17 At1g04250 26 unspecified role unspecified role prey prey physical association physical association Table S1 iaa5-iaa18 1 IAA5 At1g15580 4 unspecified role unspecified role bait bait IAA18 At1g51950 52 unspecified role unspecified role prey prey physical association physical association Table S1 iaa5-iaa19 1 IAA19 At3g15540 16 unspecified role unspecified role prey prey IAA5 At1g15580 4 unspecified role unspecified role bait bait physical association physical association Table S1 iaa5-iaa20 1 IAA5 At1g15580 4 unspecified role unspecified role bait bait IAA20 At2g46990 47 unspecified role unspecified role prey prey physical association physical association Table S1 iaa5-iaa27 1 IAA27 At4g29080 54 unspecified role unspecified role prey prey IAA5 At1g15580 4 unspecified role unspecified role bait bait physical association physical association Table S1 iaa5-iaa28 1 IAA28 At5g25890 32 unspecified role unspecified role prey prey IAA5 At1g15580 4 unspecified role unspecified role bait bait physical association physical association Table S1 iaa5-iaa29 1 IAA29 At4g32280 34 unspecified role unspecified role prey prey IAA5 At1g15580 4 unspecified role unspecified role bait bait physical association physical association Table S1 iaa5-iaa30 1 IAA5 At1g15580 4 unspecified role unspecified role bait bait IAA30 At3g62100 41 unspecified role unspecified role prey prey physical association physical association Table S1 iaa5-iaa31 1 IAA31 At3g17600 6 unspecified role unspecified role prey prey IAA5 At1g15580 4 unspecified role unspecified role bait bait physical association physical association Table S1 iaa5-iaa32 1 IAA32 At2g01200 7 unspecified role unspecified role prey prey IAA5 At1g15580 4 unspecified role unspecified role bait bait physical association physical association Table S1 iaa5-iaa33 1 IAA5 At1g15580 4 unspecified role unspecified role bait bait IAA33 At5g57420 33 unspecified role unspecified role prey prey physical association physical association Table S1 iaa5-iaa34 1 IAA34 At1g15050 11 unspecified role unspecified role prey prey IAA5 At1g15580 4 unspecified role unspecified role bait bait physical association physical association Table S1 iaa6-iaa17 1 IAA6 At1g52830 17 unspecified role unspecified role bait bait IAA17 At1g04250 26 unspecified role unspecified role prey prey physical association physical association Table S1 iaa6-iaa27 1 IAA27 At4g29080 54 unspecified role unspecified role prey prey IAA6 At1g52830 17 unspecified role unspecified role bait bait physical association physical association Table S1 iaa6-iaa34 1 IAA6 At1g52830 17 unspecified role unspecified role bait bait IAA34 At1g15050 11 unspecified role unspecified role prey prey physical association physical association Table S1 iaa7-iaa8 1 IAA7 At3g23050 36 unspecified role unspecified role bait bait IAA8 At2g22670 15 unspecified role unspecified role prey prey physical association physical association Table S1 iaa7-iaa10 1 IAA10 At1g04100 8 unspecified role unspecified role prey prey IAA7 At3g23050 36 unspecified role unspecified role bait bait physical association physical association Table S1 iaa7-iaa12 1 IAA7 At3g23050 36 unspecified role unspecified role bait bait IAA12 At1g04550 25 unspecified role unspecified role prey prey physical association physical association Table S1 iaa7-iaa13 1 IAA7 At3g23050 36 unspecified role unspecified role bait bait IAA13 At2g33310 5 unspecified role unspecified role prey prey physical association physical association Table S1 iaa7-iaa15 1 IAA7 At3g23050 36 unspecified role unspecified role bait bait IAA15 At1g80390 45 unspecified role unspecified role prey prey physical association physical association Table S1 iaa7-iaa17 1 IAA7 At3g23050 36 unspecified role unspecified role bait bait IAA17 At1g04250 26 unspecified role unspecified role prey prey physical association physical association Table S1 iaa7-iaa18 1 IAA7 At3g23050 36 unspecified role unspecified role bait bait IAA18 At1g51950 52 unspecified role unspecified role prey prey physical association physical association Table S1 iaa7-iaa20 1 IAA7 At3g23050 36 unspecified role unspecified role bait bait IAA20 At2g46990 47 unspecified role unspecified role prey prey physical association physical association Table S1 iaa7-iaa27 1 IAA7 At3g23050 36 unspecified role unspecified role bait bait IAA27 At4g29080 54 unspecified role unspecified role prey prey physical association physical association Table S1 iaa7-iaa28 1 IAA7 At3g23050 36 unspecified role unspecified role bait bait IAA28 At5g25890 32 unspecified role unspecified role prey prey physical association physical association Table S1 iaa7-iaa30 1 IAA30 At3g62100 41 unspecified role unspecified role prey prey IAA7 At3g23050 36 unspecified role unspecified role bait bait physical association physical association Table S1 iaa7-iaa32 1 IAA7 At3g23050 36 unspecified role unspecified role bait bait IAA32 At2g01200 7 unspecified role unspecified role prey prey physical association physical association Table S1 iaa7-iaa33 1 IAA7 At3g23050 36 unspecified role unspecified role bait bait IAA33 At5g57420 33 unspecified role unspecified role prey prey physical association physical association Table S1 iaa7-iaa34 1 IAA34 At1g15050 11 unspecified role unspecified role prey prey IAA7 At3g23050 36 unspecified role unspecified role bait bait physical association physical association Table S1 iaa8-iaa8 1 IAA8 At2g22670 15 unspecified role unspecified role bait bait IAA8 At2g22670 15 unspecified role unspecified role prey prey physical association physical association Table S1 iaa8-iaa9 1 IAA8 At2g22670 15 unspecified role unspecified role bait bait IAA9 At5g65670 27 unspecified role unspecified role prey prey physical association physical association Table S1 iaa8-iaa10 1 IAA10 At1g04100 8 unspecified role unspecified role prey prey IAA8 At2g22670 15 unspecified role unspecified role bait bait physical association physical association Table S1 iaa8-iaa12 1 IAA12 At1g04550 25 unspecified role unspecified role prey prey IAA8 At2g22670 15 unspecified role unspecified role bait bait physical association physical association Table S1 iaa8-iaa14 1 IAA14 At4g14550 13 unspecified role unspecified role prey prey IAA8 At2g22670 15 unspecified role unspecified role bait bait physical association physical association Table S1 iaa8-iaa15 1 IAA8 At2g22670 15 unspecified role unspecified role bait bait IAA15 At1g80390 45 unspecified role unspecified role prey prey physical association physical association Table S1 iaa8-iaa16 1 IAA16 At3g04730 49 unspecified role unspecified role prey prey IAA8 At2g22670 15 unspecified role unspecified role bait bait physical association physical association Table S1 iaa8-iaa17 1 IAA17 At1g04250 26 unspecified role unspecified role prey prey IAA8 At2g22670 15 unspecified role unspecified role bait bait physical association physical association Table S1 iaa8-iaa18 1 IAA8 At2g22670 15 unspecified role unspecified role bait bait IAA18 At1g51950 52 unspecified role unspecified role prey prey physical association physical association Table S1 iaa8-iaa19 1 IAA8 At2g22670 15 unspecified role unspecified role bait bait IAA19 At3g15540 16 unspecified role unspecified role prey prey physical association physical association Table S1 iaa8-iaa20 1 IAA20 At2g46990 47 unspecified role unspecified role prey prey IAA8 At2g22670 15 unspecified role unspecified role bait bait physical association physical association Table S1 iaa8-iaa27 1 IAA27 At4g29080 54 unspecified role unspecified role prey prey IAA8 At2g22670 15 unspecified role unspecified role bait bait physical association physical association Table S1 iaa8-iaa28 1 IAA8 At2g22670 15 unspecified role unspecified role bait bait IAA28 At5g25890 32 unspecified role unspecified role prey prey physical association physical association Table S1 iaa8-iaa34 1 IAA8 At2g22670 15 unspecified role unspecified role bait bait IAA34 At1g15050 11 unspecified role unspecified role prey prey physical association physical association Table S1 iaa9-iaa9 1 IAA9 At5g65670 27 unspecified role unspecified role bait bait IAA9 At5g65670 27 unspecified role unspecified role prey prey physical association physical association Table S1 iaa9-iaa10 1 IAA10 At1g04100 8 unspecified role unspecified role prey prey IAA9 At5g65670 27 unspecified role unspecified role bait bait physical association physical association Table S1 iaa9-iaa11 1 IAA11 At4g28640 48 unspecified role unspecified role prey prey IAA9 At5g65670 27 unspecified role unspecified role bait bait physical association physical association Table S1 iaa9-iaa12 1 IAA12 At1g04550 25 unspecified role unspecified role prey prey IAA9 At5g65670 27 unspecified role unspecified role bait bait physical association physical association Table S1 iaa9-iaa13 1 IAA13 At2g33310 5 unspecified role unspecified role prey prey IAA9 At5g65670 27 unspecified role unspecified role bait bait physical association physical association Table S1 iaa9-iaa14 1 IAA14 At4g14550 13 unspecified role unspecified role prey prey IAA9 At5g65670 27 unspecified role unspecified role bait bait physical association physical association Table S1 iaa9-iaa15 1 IAA15 At1g80390 45 unspecified role unspecified role prey prey IAA9 At5g65670 27 unspecified role unspecified role bait bait physical association physical association Table S1 iaa9-iaa16 1 IAA16 At3g04730 49 unspecified role unspecified role prey prey IAA9 At5g65670 27 unspecified role unspecified role bait bait physical association physical association Table S1 iaa9-iaa17 1 IAA17 At1g04250 26 unspecified role unspecified role prey prey IAA9 At5g65670 27 unspecified role unspecified role bait bait physical association physical association Table S1 iaa9-iaa18 1 IAA9 At5g65670 27 unspecified role unspecified role bait bait IAA18 At1g51950 52 unspecified role unspecified role prey prey physical association physical association Table S1 iaa9-iaa19 1 IAA19 At3g15540 16 unspecified role unspecified role prey prey IAA9 At5g65670 27 unspecified role unspecified role bait bait physical association physical association Table S1 iaa9-iaa26 1 IAA9 At5g65670 27 unspecified role unspecified role bait bait IAA26 At3g16500 14 unspecified role unspecified role prey prey physical association physical association Table S1 iaa9-iaa27 1 IAA27 At4g29080 54 unspecified role unspecified role prey prey IAA9 At5g65670 27 unspecified role unspecified role bait bait physical association physical association Table S1 iaa9-iaa28 1 IAA9 At5g65670 27 unspecified role unspecified role bait bait IAA28 At5g25890 32 unspecified role unspecified role prey prey physical association physical association Table S1 iaa9-iaa34 1 IAA34 At1g15050 11 unspecified role unspecified role prey prey IAA9 At5g65670 27 unspecified role unspecified role bait bait physical association physical association Table S1 iaa10-iaa10 1 IAA10 At1g04100 8 unspecified role unspecified role prey prey IAA10 At1g04100 8 unspecified role unspecified role bait bait physical association physical association Table S1 iaa10-iaa15 1 IAA15 At1g80390 45 unspecified role unspecified role prey prey IAA10 At1g04100 8 unspecified role unspecified role bait bait physical association physical association Table S1 iaa10-iaa16 1 IAA16 At3g04730 49 unspecified role unspecified role prey prey IAA10 At1g04100 8 unspecified role unspecified role bait bait physical association physical association Table S1 iaa10-iaa17 1 IAA10 At1g04100 8 unspecified role unspecified role bait bait IAA17 At1g04250 26 unspecified role unspecified role prey prey physical association physical association Table S1 iaa10-iaa18 1 IAA18 At1g51950 52 unspecified role unspecified role prey prey IAA10 At1g04100 8 unspecified role unspecified role bait bait physical association physical association Table S1 iaa10-iaa19 1 IAA19 At3g15540 16 unspecified role unspecified role prey prey IAA10 At1g04100 8 unspecified role unspecified role bait bait physical association physical association Table S1 iaa10-iaa27 1 IAA27 At4g29080 54 unspecified role unspecified role prey prey IAA10 At1g04100 8 unspecified role unspecified role bait bait physical association physical association Table S1 iaa10-iaa28 1 IAA10 At1g04100 8 unspecified role unspecified role bait bait IAA28 At5g25890 32 unspecified role unspecified role prey prey physical association physical association Table S1 iaa10-iaa30 1 IAA10 At1g04100 8 unspecified role unspecified role bait bait IAA30 At3g62100 41 unspecified role unspecified role prey prey physical association physical association Table S1 iaa10-iaa31 1 IAA10 At1g04100 8 unspecified role unspecified role bait bait IAA31 At3g17600 6 unspecified role unspecified role prey prey physical association physical association Table S1 iaa10-iaa34 1 IAA34 At1g15050 11 unspecified role unspecified role prey prey IAA10 At1g04100 8 unspecified role unspecified role bait bait physical association physical association Table S1 iaa11-iaa16 1 IAA11 At4g28640 48 unspecified role unspecified role bait bait IAA16 At3g04730 49 unspecified role unspecified role prey prey physical association physical association Table S1 iaa11-iaa19 1 IAA11 At4g28640 48 unspecified role unspecified role bait bait IAA19 At3g15540 16 unspecified role unspecified role prey prey physical association physical association Table S1 iaa11-iaa28 1 IAA11 At4g28640 48 unspecified role unspecified role bait bait IAA28 At5g25890 32 unspecified role unspecified role prey prey physical association physical association Table S1 iaa11-iaa30 1 IAA11 At4g28640 48 unspecified role unspecified role bait bait IAA30 At3g62100 41 unspecified role unspecified role prey prey physical association physical association Table S1 iaa12-iaa12 1 IAA12 At1g04550 25 unspecified role unspecified role bait bait IAA12 At1g04550 25 unspecified role unspecified role prey prey physical association physical association Table S1 iaa12-iaa13 1 IAA13 At2g33310 5 unspecified role unspecified role prey prey IAA12 At1g04550 25 unspecified role unspecified role bait bait physical association physical association Table S1 iaa12-iaa14 1 IAA14 At4g14550 13 unspecified role unspecified role prey prey IAA12 At1g04550 25 unspecified role unspecified role bait bait physical association physical association Table S1 iaa12-iaa15 1 IAA15 At1g80390 45 unspecified role unspecified role prey prey IAA12 At1g04550 25 unspecified role unspecified role bait bait physical association physical association Table S1 iaa12-iaa16 1 IAA12 At1g04550 25 unspecified role unspecified role bait bait IAA16 At3g04730 49 unspecified role unspecified role prey prey physical association physical association Table S1 iaa12-iaa17 1 IAA12 At1g04550 25 unspecified role unspecified role bait bait IAA17 At1g04250 26 unspecified role unspecified role prey prey physical association physical association Table S1 iaa12-iaa18 1 IAA18 At1g51950 52 unspecified role unspecified role prey prey IAA12 At1g04550 25 unspecified role unspecified role bait bait physical association physical association Table S1 iaa12-iaa19 1 IAA19 At3g15540 16 unspecified role unspecified role prey prey IAA12 At1g04550 25 unspecified role unspecified role bait bait physical association physical association Table S1 iaa12-iaa20 1 IAA12 At1g04550 25 unspecified role unspecified role bait bait IAA20 At2g46990 47 unspecified role unspecified role prey prey physical association physical association Table S1 iaa12-iaa28 1 IAA12 At1g04550 25 unspecified role unspecified role bait bait IAA28 At5g25890 32 unspecified role unspecified role prey prey physical association physical association Table S1 iaa12-iaa30 1 IAA12 At1g04550 25 unspecified role unspecified role bait bait IAA30 At3g62100 41 unspecified role unspecified role prey prey physical association physical association Table S1 iaa12-iaa31 1 IAA12 At1g04550 25 unspecified role unspecified role bait bait IAA31 At3g17600 6 unspecified role unspecified role prey prey physical association physical association Table S1 iaa13-iaa14 1 IAA14 At4g14550 13 unspecified role unspecified role prey prey IAA13 At2g33310 5 unspecified role unspecified role bait bait physical association physical association Table S1 iaa13-iaa15 1 IAA15 At1g80390 45 unspecified role unspecified role prey prey IAA13 At2g33310 5 unspecified role unspecified role bait bait physical association physical association Table S1 iaa13-iaa16 1 IAA13 At2g33310 5 unspecified role unspecified role bait bait IAA16 At3g04730 49 unspecified role unspecified role prey prey physical association physical association Table S1 iaa13-iaa17 1 IAA13 At2g33310 5 unspecified role unspecified role bait bait IAA17 At1g04250 26 unspecified role unspecified role prey prey physical association physical association Table S1 iaa13-iaa19 1 IAA13 At2g33310 5 unspecified role unspecified role bait bait IAA19 At3g15540 16 unspecified role unspecified role prey prey physical association physical association Table S1 iaa13-iaa27 1 IAA27 At4g29080 54 unspecified role unspecified role prey prey IAA13 At2g33310 5 unspecified role unspecified role bait bait physical association physical association Table S1 iaa13-iaa30 1 IAA13 At2g33310 5 unspecified role unspecified role bait bait IAA30 At3g62100 41 unspecified role unspecified role prey prey physical association physical association Table S1 iaa13-iaa34 1 IAA13 At2g33310 5 unspecified role unspecified role bait bait IAA34 At1g15050 11 unspecified role unspecified role prey prey physical association physical association Table S1 iaa14-iaa16 1 IAA16 At3g04730 49 unspecified role unspecified role prey prey IAA14 At4g14550 13 unspecified role unspecified role bait bait physical association physical association Table S1 iaa14-iaa17 1 IAA14 At4g14550 13 unspecified role unspecified role bait bait IAA17 At1g04250 26 unspecified role unspecified role prey prey physical association physical association Table S1 iaa14-iaa19 1 IAA14 At4g14550 13 unspecified role unspecified role bait bait IAA19 At3g15540 16 unspecified role unspecified role prey prey physical association physical association Table S1 iaa14-iaa26 1 IAA14 At4g14550 13 unspecified role unspecified role bait bait IAA26 At3g16500 14 unspecified role unspecified role prey prey physical association physical association Table S1 iaa14-iaa27 1 IAA14 At4g14550 13 unspecified role unspecified role bait bait IAA27 At4g29080 54 unspecified role unspecified role prey prey physical association physical association Table S1 iaa14-iaa28 1 IAA14 At4g14550 13 unspecified role unspecified role bait bait IAA28 At5g25890 32 unspecified role unspecified role prey prey physical association physical association Table S1 iaa14-iaa33 1 IAA14 At4g14550 13 unspecified role unspecified role bait bait IAA33 At5g57420 33 unspecified role unspecified role prey prey physical association physical association Table S1 iaa14-iaa34 1 IAA14 At4g14550 13 unspecified role unspecified role bait bait IAA34 At1g15050 11 unspecified role unspecified role prey prey physical association physical association Table S1 iaa15-iaa15 1 IAA15 At1g80390 45 unspecified role unspecified role prey prey IAA15 At1g80390 45 unspecified role unspecified role bait bait physical association physical association Table S1 iaa15-iaa16 1 IAA16 At3g04730 49 unspecified role unspecified role prey prey IAA15 At1g80390 45 unspecified role unspecified role bait bait physical association physical association Table S1 iaa15-iaa17 1 IAA17 At1g04250 26 unspecified role unspecified role prey prey IAA15 At1g80390 45 unspecified role unspecified role bait bait physical association physical association Table S1 iaa15-iaa18 1 IAA15 At1g80390 45 unspecified role unspecified role bait bait IAA18 At1g51950 52 unspecified role unspecified role prey prey physical association physical association Table S1 iaa15-iaa19 1 IAA15 At1g80390 45 unspecified role unspecified role bait bait IAA19 At3g15540 16 unspecified role unspecified role prey prey physical association physical association Table S1 iaa15-iaa20 1 IAA20 At2g46990 47 unspecified role unspecified role prey prey IAA15 At1g80390 45 unspecified role unspecified role bait bait physical association physical association Table S1 iaa15-iaa30 1 IAA30 At3g62100 41 unspecified role unspecified role prey prey IAA15 At1g80390 45 unspecified role unspecified role bait bait physical association physical association Table S1 iaa15-iaa32 1 IAA15 At1g80390 45 unspecified role unspecified role bait bait IAA32 At2g01200 7 unspecified role unspecified role prey prey physical association physical association Table S1 iaa15-iaa33 1 IAA15 At1g80390 45 unspecified role unspecified role bait bait IAA33 At5g57420 33 unspecified role unspecified role prey prey physical association physical association Table S1 iaa15-iaa34 1 IAA15 At1g80390 45 unspecified role unspecified role bait bait IAA34 At1g15050 11 unspecified role unspecified role prey prey physical association physical association Table S1 iaa16-iaa16 1 IAA16 At3g04730 49 unspecified role unspecified role prey prey IAA16 At3g04730 49 unspecified role unspecified role bait bait physical association physical association Table S1 iaa16-iaa17 1 IAA17 At1g04250 26 unspecified role unspecified role prey prey IAA16 At3g04730 49 unspecified role unspecified role bait bait physical association physical association Table S1 iaa16-iaa18 1 IAA16 At3g04730 49 unspecified role unspecified role bait bait IAA18 At1g51950 52 unspecified role unspecified role prey prey physical association physical association Table S1 iaa16-iaa19 1 IAA19 At3g15540 16 unspecified role unspecified role prey prey IAA16 At3g04730 49 unspecified role unspecified role bait bait physical association physical association Table S1 iaa16-iaa26 1 IAA16 At3g04730 49 unspecified role unspecified role bait bait IAA26 At3g16500 14 unspecified role unspecified role prey prey physical association physical association Table S1 iaa16-iaa27 1 IAA27 At4g29080 54 unspecified role unspecified role prey prey IAA16 At3g04730 49 unspecified role unspecified role bait bait physical association physical association Table S1 iaa16-iaa28 1 IAA28 At5g25890 32 unspecified role unspecified role prey prey IAA16 At3g04730 49 unspecified role unspecified role bait bait physical association physical association Table S1 iaa16-iaa30 1 IAA16 At3g04730 49 unspecified role unspecified role bait bait IAA30 At3g62100 41 unspecified role unspecified role prey prey physical association physical association Table S1 iaa16-iaa31 1 IAA16 At3g04730 49 unspecified role unspecified role bait bait IAA31 At3g17600 6 unspecified role unspecified role prey prey physical association physical association Table S1 iaa16-iaa32 1 IAA32 At2g01200 7 unspecified role unspecified role prey prey IAA16 At3g04730 49 unspecified role unspecified role bait bait physical association physical association Table S1 iaa16-iaa33 1 IAA16 At3g04730 49 unspecified role unspecified role bait bait IAA33 At5g57420 33 unspecified role unspecified role prey prey physical association physical association Table S1 iaa16-iaa34 1 IAA16 At3g04730 49 unspecified role unspecified role bait bait IAA34 At1g15050 11 unspecified role unspecified role prey prey physical association physical association Table S1 iaa17-iaa17 1 IAA17 At1g04250 26 unspecified role unspecified role prey prey IAA17 At1g04250 26 unspecified role unspecified role bait bait physical association physical association Table S1 iaa17-iaa18 1 IAA18 At1g51950 52 unspecified role unspecified role prey prey IAA17 At1g04250 26 unspecified role unspecified role bait bait physical association physical association Table S1 iaa17-iaa19 1 IAA17 At1g04250 26 unspecified role unspecified role bait bait IAA19 At3g15540 16 unspecified role unspecified role prey prey physical association physical association Table S1 iaa17-iaa20 1 IAA20 At2g46990 47 unspecified role unspecified role prey prey IAA17 At1g04250 26 unspecified role unspecified role bait bait physical association physical association Table S1 iaa17-iaa26 1 IAA17 At1g04250 26 unspecified role unspecified role bait bait IAA26 At3g16500 14 unspecified role unspecified role prey prey physical association physical association Table S1 iaa17-iaa27 1 IAA27 At4g29080 54 unspecified role unspecified role prey prey IAA17 At1g04250 26 unspecified role unspecified role bait bait physical association physical association Table S1 iaa17-iaa28 1 IAA28 At5g25890 32 unspecified role unspecified role prey prey IAA17 At1g04250 26 unspecified role unspecified role bait bait physical association physical association Table S1 iaa17-iaa29 1 IAA17 At1g04250 26 unspecified role unspecified role bait bait IAA29 At4g32280 34 unspecified role unspecified role prey prey physical association physical association Table S1 iaa17-iaa31 1 IAA17 At1g04250 26 unspecified role unspecified role bait bait IAA31 At3g17600 6 unspecified role unspecified role prey prey physical association physical association Table S1 iaa17-iaa34 1 IAA34 At1g15050 11 unspecified role unspecified role prey prey IAA17 At1g04250 26 unspecified role unspecified role bait bait physical association physical association Table S1 iaa18-iaa20 1 IAA18 At1g51950 52 unspecified role unspecified role bait bait IAA20 At2g46990 47 unspecified role unspecified role prey prey physical association physical association Table S1 iaa18-iaa27 1 IAA27 At4g29080 54 unspecified role unspecified role prey prey IAA18 At1g51950 52 unspecified role unspecified role bait bait physical association physical association Table S1 iaa18-iaa28 1 IAA18 At1g51950 52 unspecified role unspecified role bait bait IAA28 At5g25890 32 unspecified role unspecified role prey prey physical association physical association Table S1 iaa18-iaa31 1 IAA18 At1g51950 52 unspecified role unspecified role bait bait IAA31 At3g17600 6 unspecified role unspecified role prey prey physical association physical association Table S1 iaa18-iaa34 1 IAA34 At1g15050 11 unspecified role unspecified role prey prey IAA18 At1g51950 52 unspecified role unspecified role bait bait physical association physical association Table S1 iaa19-iaa26 1 IAA19 At3g15540 16 unspecified role unspecified role bait bait IAA26 At3g16500 14 unspecified role unspecified role prey prey physical association physical association Table S1 iaa19-iaa28 1 IAA19 At3g15540 16 unspecified role unspecified role bait bait IAA28 At5g25890 32 unspecified role unspecified role prey prey physical association physical association Table S1 iaa19-iaa31 1 IAA19 At3g15540 16 unspecified role unspecified role bait bait IAA31 At3g17600 6 unspecified role unspecified role prey prey physical association physical association Table S1 iaa19-iaa34 1 IAA34 At1g15050 11 unspecified role unspecified role prey prey IAA19 At3g15540 16 unspecified role unspecified role bait bait physical association physical association Table S1 iaa20-iaa28 1 IAA28 At5g25890 32 unspecified role unspecified role prey prey IAA20 At2g46990 47 unspecified role unspecified role bait bait physical association physical association Table S1 iaa20-iaa30 1 IAA30 At3g62100 41 unspecified role unspecified role prey prey IAA20 At2g46990 47 unspecified role unspecified role bait bait physical association physical association Table S1 iaa20-iaa32 1 IAA32 At2g01200 7 unspecified role unspecified role prey prey IAA20 At2g46990 47 unspecified role unspecified role bait bait physical association physical association Table S1 iaa20-iaa33 1 IAA20 At2g46990 47 unspecified role unspecified role bait bait IAA33 At5g57420 33 unspecified role unspecified role prey prey physical association physical association Table S1 iaa20-iaa34 1 IAA34 At1g15050 11 unspecified role unspecified role prey prey IAA20 At2g46990 47 unspecified role unspecified role bait bait physical association physical association Table S1 iaa26-iaa28 1 IAA26 At3g16500 14 unspecified role unspecified role bait bait IAA28 At5g25890 32 unspecified role unspecified role prey prey physical association physical association Table S1 iaa26-iaa30 1 IAA30 At3g62100 41 unspecified role unspecified role prey prey IAA26 At3g16500 14 unspecified role unspecified role bait bait physical association physical association Table S1 iaa26-iaa34 1 IAA26 At3g16500 14 unspecified role unspecified role bait bait IAA34 At1g15050 11 unspecified role unspecified role prey prey physical association physical association Table S1 iaa27-iaa27 1 IAA27 At4g29080 54 unspecified role unspecified role bait bait IAA27 At4g29080 54 unspecified role unspecified role prey prey physical association physical association Table S1 iaa27-iaa28 1 IAA28 At5g25890 32 unspecified role unspecified role prey prey IAA27 At4g29080 54 unspecified role unspecified role bait bait physical association physical association Table S1 iaa27-iaa30 1 IAA27 At4g29080 54 unspecified role unspecified role bait bait IAA30 At3g62100 41 unspecified role unspecified role prey prey physical association physical association Table S1 iaa27-iaa31 1 IAA27 At4g29080 54 unspecified role unspecified role bait bait IAA31 At3g17600 6 unspecified role unspecified role prey prey physical association physical association Table S1 iaa27-iaa33 1 IAA33 At5g57420 33 unspecified role unspecified role prey prey IAA27 At4g29080 54 unspecified role unspecified role bait bait physical association physical association Table S1 iaa27-iaa34 1 IAA27 At4g29080 54 unspecified role unspecified role bait bait IAA34 At1g15050 11 unspecified role unspecified role prey prey physical association physical association Table S1 iaa28-iaa30 1 IAA30 At3g62100 41 unspecified role unspecified role prey prey IAA28 At5g25890 32 unspecified role unspecified role bait bait physical association physical association Table S1 iaa28-iaa31 1 IAA28 At5g25890 32 unspecified role unspecified role bait bait IAA31 At3g17600 6 unspecified role unspecified role prey prey physical association physical association Table S1 iaa28-iaa33 1 IAA28 At5g25890 32 unspecified role unspecified role bait bait IAA33 At5g57420 33 unspecified role unspecified role prey prey physical association physical association Table S1 iaa28-iaa34 1 IAA34 At1g15050 11 unspecified role unspecified role prey prey IAA28 At5g25890 32 unspecified role unspecified role bait bait physical association physical association Table S1 iaa29-iaa33 1 IAA29 At4g32280 34 unspecified role unspecified role bait bait IAA33 At5g57420 33 unspecified role unspecified role prey prey physical association physical association Table S1 iaa29-iaa34 1 IAA34 At1g15050 11 unspecified role unspecified role prey prey IAA29 At4g32280 34 unspecified role unspecified role bait bait physical association physical association Table S1 iaa30-iaa33 1 IAA33 At5g57420 33 unspecified role unspecified role prey prey IAA30 At3g62100 41 unspecified role unspecified role bait bait physical association physical association Table S1 iaa30-iaa34 1 IAA34 At1g15050 11 unspecified role unspecified role prey prey IAA30 At3g62100 41 unspecified role unspecified role bait bait physical association physical association Table S1 iaa31-iaa31 1 IAA31 At3g17600 6 unspecified role unspecified role bait bait IAA31 At3g17600 6 unspecified role unspecified role prey prey physical association physical association Table S1 iaa31-iaa34 1 IAA34 At1g15050 11 unspecified role unspecified role prey prey IAA31 At3g17600 6 unspecified role unspecified role bait bait physical association physical association Table S1 iaa32-iaa34 1 IAA34 At1g15050 11 unspecified role unspecified role prey prey IAA32 At2g01200 7 unspecified role unspecified role bait bait physical association physical association Table S1 iaa33-iaa34 1 IAA33 At5g57420 33 unspecified role unspecified role bait bait IAA34 At1g15050 11 unspecified role unspecified role prey prey physical association physical association Table S1 iaa34-iaa34 1 IAA34 At1g15050 11 unspecified role unspecified role bait bait IAA34 At1g15050 11 unspecified role unspecified role prey prey physical association physical association Table S1 arf5-arf5-3 2 40 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 40 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary Figure 4 Table S2 arff-arfi 2 43 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary Figure 4 Table S2 arfe-iaa12 2 40 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 25 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary Figure 4 Table S2 arff-iaa8 2 43 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary Figure 4 Table S2 arf6-iaa17-1 2 26 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 43 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary Figure 4 Table S2 arf6-iaa18-1 2 43 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 52 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary Figure 4 Table S2 arf6-iaa28-1 2 43 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 32 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary Figure 4 Table S2 arf8-iaa12-1 2 44 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 25 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary Figure 4 Table S2 arf9-iaa8 2 15 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary Figure 4 Table S2 arf9-iaa17-1 2 26 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary Figure 4 Table S2 arf9-iaa18-1 2 52 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary Figure 4 Table S2 arf9-iaa28-1 2 21 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 32 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary Figure 4 Table S2 arf18-iaa17 2 46 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 26 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary Figure 4 Table S2 iaa8-iaa8 2 15 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary Figure 4 Table S2 iaa8-iaa12-1 2 15 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 25 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary Figure 4 Table S2 iaa8-iaa17-1 2 15 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 26 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary Figure 4 Table S2 iaa18-iaa8 2 15 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 52 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary Figure 4 Table S2 iaa28-iaa8 2 32 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary Figure 4 Table S2 iaa12-iaa17-1 2 26 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 25 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary Figure 4 Table S2 iaa12-iaa18-1 2 25 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 52 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary Figure 4 Table S2 iaa17-iaa18 2 26 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 26 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 26 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 52 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary Figure 4 Table S2 iaa28-iaa18 2 32 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 52 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary Figure 4 Table S2 iaa17-iaa17-1 2 26 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 26 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary Figure 4 Table S2 iaa28-afb5 3 32 unspecified role unspecified role bait bait n terminal biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range domain ii sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 38 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Fig. 5E iaa28-tir1 3 32 unspecified role unspecified role bait bait domain ii sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n terminal biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) 29 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Fig. 5E iaa28-afb1 3 18 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 32 unspecified role unspecified role bait bait domain ii sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n terminal biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 5E