MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The functions of the actin nucleator Cobl in cellular morphogenesis critically depend on syndapin I. The functions of the actin nucleator Cobl in cellular morphogenesis critically depend on syndapin I. EMBO J. (0261-4189) 2011 imex curation Schwintzer L., Koch N., Ahuja R., Grimm J., Kessels MM., Qualmann B. Only protein-protein interactions rat-brain Rattus norvegicus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Schwintzer L., Koch N., Ahuja R., Grimm J., Kessels MM., Qualmann B. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation The functions of the actin nucleator Cobl in cellular morphogenesis critically depend on syndapin I. The functions of the actin nucleator Cobl in cellular morphogenesis critically depend on syndapin I. EMBO J. (0261-4189) 2011 imex curation Schwintzer L., Koch N., Ahuja R., Grimm J., Kessels MM., Qualmann B. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Schwintzer L., Koch N., Ahuja R., Grimm J., Kessels MM., Qualmann B. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation The functions of the actin nucleator Cobl in cellular morphogenesis critically depend on syndapin I. The functions of the actin nucleator Cobl in cellular morphogenesis critically depend on syndapin I. EMBO J. (0261-4189) 2011 imex curation Schwintzer L., Koch N., Ahuja R., Grimm J., Kessels MM., Qualmann B. Only protein-protein interactions rat-hippocampus_neuron Rattus norvegicus brain-hippocampus_neuron Hippocampal neuron fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Schwintzer L., Koch N., Ahuja R., Grimm J., Kessels MM., Qualmann B. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation The functions of the actin nucleator Cobl in cellular morphogenesis critically depend on syndapin I. The functions of the actin nucleator Cobl in cellular morphogenesis critically depend on syndapin I. EMBO J. (0261-4189) 2011 imex curation Schwintzer L., Koch N., Ahuja R., Grimm J., Kessels MM., Qualmann B. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Schwintzer L., Koch N., Ahuja R., Grimm J., Kessels MM., Qualmann B. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation The functions of the actin nucleator Cobl in cellular morphogenesis critically depend on syndapin I. The functions of the actin nucleator Cobl in cellular morphogenesis critically depend on syndapin I. EMBO J. (0261-4189) 2011 imex curation Schwintzer L., Koch N., Ahuja R., Grimm J., Kessels MM., Qualmann B. Only protein-protein interactions in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Schwintzer L., Koch N., Ahuja R., Grimm J., Kessels MM., Qualmann B. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation The functions of the actin nucleator Cobl in cellular morphogenesis critically depend on syndapin I. The functions of the actin nucleator Cobl in cellular morphogenesis critically depend on syndapin I. EMBO J. (0261-4189) 2011 imex curation Schwintzer L., Koch N., Ahuja R., Grimm J., Kessels MM., Qualmann B. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Schwintzer L., Koch N., Ahuja R., Grimm J., Kessels MM., Qualmann B. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation wasl_rat Neural Wiskott-Aldrich syndrome protein Wasl protein protein rat Rattus norvegicus (Rat) Rat MSSGQQPPRRVTNVGSLLLTPQENESLFSFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDAPNGPNLPMATVDIKNPEITTNRFYSSQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHSSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPGVVVPPPPPNRMYPPPPPALPSSAPSGPPPPPPLSMAGSTAPPPPPPPPPPPGPPPPPGLPSDGDHQVPASSGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGQESTPPTPAPTSGIVGALMEVMQKRSKAIHSSDEDEDDDDEEDFQDDDEWED DIP protein O08816 original sequence version: 145 DIP protein O08816 original sequence version: 115 480E21F26F7FC77E q5i2z0_rat Pacsin3 SdpIII protein protein rat Rattus norvegicus (Rat) Rat MAPEEDAGGEVLVGSFWEAGNYRRTVQRVEDGHRLCGDLISCFQERARIEKAYAQQLADWARKWRGAVEKGPQYGTLEKAWHAFFTAAERLSELHLEVREKLHGPDSERVRTWQRGAFHRPVLGGFRESRAAEDGFRKAQKPWLKRLKEVEASKKSYHTARKDEKTAQTRESHAKADSSMSQEQLRKLQERVGRCTKEAEKMKTQYEQTLAELNRYTPRYMEDMEQAFESCQAAERQRLLFFKDVLLTLHQHLDLSSSDKFHELHRDLQRGIEDASDEEDLRWWRSTHGPGMAMNWPQFEEWSLDTQRAISRKEKGGRSPDEVTLTSIVPTRDGTAPPPQSPSSPGSGQDEDWSDEESPRKAGTGVRVRALYDYAGQEADELSFRAGEELLKMSEEDEQGWCQGQLQSGRIGLYPANYVECVGA mint C393D375A6B87A58 cobl_rat Protein cordon-bleu Cobl protein protein rat Rattus norvegicus (Rat) Rat MKARAPPPPGKPAAQNVHSEQKLPHDATLGSQQSLVHLKEALHNSTLDITVVLPSGLEKQSVVSGSRAVMDLLVELCLQNHLNPSHHVLEIWSSETQQPLSFKPNTLIGSLNAHTVFLKEKVPEEKGKPGLTKAPEKSVRLVVNYLRTQKAVMRVSPEVPLQNILPVICAKCEVSPDHVVLLRDNIAGEELELSKSLNELGIKELYAWDNRREMLRKSSLGNDETDKEKKKFLGFFKVNKRSNSKAEHLGLSGADSDEDPSKSASGGDLNGCVTTPNSPSLHSRSLTLGPSLSLGNISGMSMKSDMKKRRAPPPPSPGLLGQDKVSEKASLSSQADLQKKKRRAPAPPPPQPPPPSPVVPNRKEDKEENRKSTVGMEENYETDTSSLTSSVNGVSNHSLQEAIIPDSGVDDIPVTFIGEVSDEPFDSGLFFSGSNNAAALNQGGIASQRSHLPPYQTEQSQPFIRTNRKEPDPSLPSQDYRKRNQPILANTSENENPVGIDPRVTSFVSKPSTDDPKAKDKDKMCGSGPSEKTQTGHRVNSLPVNPRVGEDENSNSALPPWSHHGQASGGSYGLKYGLTTYKIVPPKPEMRCYDRDVSLSTGAIKIDELGNLMSPHMNGSRTISKPSAVAETEAPPIGKVKEFWRRNSMEKYLNGPAECTVKKAPSTTITATSEKPQRDETKAGFTLTTPEQQPASQEYGAPPEEDRSRPHSAVSCPVKVPAPNPTDITFLKPQRRTSSQYVASAIAKKMGPPKVHADVVRPHKKTAEQGHEEAKLARPPPAWKDSAVPNLCSEAGQCEHGTNQGSVRLPSNPGGQLPADHPKVEVNSTYGKSATHNSPAAVHRNSYFLPGRSSQRDRVSVGQSCGFHEKQTISNQKMNSTSNPSQALDKAHPAPLLLTEARDSGRILVNGSAQTPGNCEPPHSQKESTLTSYIILQTEEKPSPLSADGQNSDDALPSSIFGPKKKFKPVVQRPLPKDISLHSALMEAIHTSGGRDKLRKTAEQASEGRPKKPSYVEAESERSALLAAIRGHSGTLSLRKVSSLASEELQSFRDAALMAPGVDKPQQEDRGLPPPPALPPPSTPASQVPSASIPVSRFSIGTLSNPVNARQALMDAIRSGTGAARLRKVPLLV DIP protein D3ZUI5 original sequence version: 41 mint homomint A1DFF048013B5403 pacn1_rat Protein kinase C and casein kinase substrate in neurons protein 1 Pacsin1 Synaptic, dynamin-associated protein I Syndapin-I Dynamin proline-rich domain-interacting protein Syndapin-1 protein protein rat Rattus norvegicus (Rat) Rat MSGPYDEASEEITDSFWEVGNYKRTVKRIDDGHRLCNDLMSCVQERAKIEKAYAQQLTDWAKRWRQLIEKGPQYGSLERAWGAMMTEADKVSELHQEVKNSLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEEKLAMTREMNSKTEQSVTPEQQKKLVDKVDKCRQDVQKTQEKYEKVLEDVGKTTPQYMEGMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNPDLPHTAAKKEKQPKKAEGAALSNATGAVESTSQAGDRGSVSSYDRGQAYATEWSDDESGNPFGGNEANGGANPFEDDAKGVRVRALYDYDGQEQDELSFKAGDELTKLGEEDEQGWCRGRLDSGQLGLYPANYVEAI DIP protein Q9Z0W5 original sequence version: 106 585B328850572DF8 pacn2_rat Protein kinase C and casein kinase substrate in neurons 2 protein Synaptic dynamin-associated protein II Syndapin-II Pacsin2 Syndapin-2 protein protein rat Rattus norvegicus (Rat) Rat MSVTYDDSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCGDLMNCLHERARIEKAYAQQLTEWARRWRQLVEKGPQYGTVEKAWMAVMSEAERVSELHLEVKASLMNEDFEKIKNWQKEAFHKQMMGGFKETKEAEDGFRKAQKPWAKKLKEVDAAKKAHHTACKEEKLAVSREANSKADPSLNPEQLKKLQDKIEKCKQDVLKTKDKYEKALKELDQTTPQYMENMEQVFEQCQQFEEKRLRFFREVLLEVQKHLDLSNVASYKGIYRELEQSIKAADAVEDLRWFRANHGPGMAMNWPQFEDEEWSADLNRTLSRREKKKAADGVTLTGINQTGDQSGQNKPSSNLSVPSNPAQSTQLQSSYNPFEDEDDTGSSVSEKEDIKAKNVSSYEKTQNYPADWSDDESNNPFSSTDANGDSNPFDEDTTSGTEVRVRALYDYEGQEHDELSFKAGDELTKIEDEDEQGWCKGRLDSGQVGLYPANYVEAIQ B2975012EF0FDF56 cobl_mouse Protein cordon-bleu Cobl Kiaa0633 protein protein mouse Mus musculus Mouse MDAPRALAAKPPTGRKMKARAPPPPGKPAAQNVHSEQKLPHDATLGSQQSLVYMKEALQNSTLDITVVLPSGLEKQSVVSGSHAMMDLLVELCLQNHLNPSHHVLEIWSSETQQPLSFKPNTLIGSLNVHTVLLKEKVPEERVKPGLTKAPEKSVRLVVNYLRTQKAVVRVSPEVPLQNILPVICAKCEVNPEHVILLRDNVAGEELELSKSLNELGIKELYAWDNRREMFRKSSLGNDETDKEKKKFLGFFKANKRSNSKAEHLGLSGADSDEDPAKSASGGDLNGCVTTPNSPSLHSRSLTLGPSLSLGNISGVSMKSDMKKRRAPPPPSPKLLGQDKVSEKASLSSQADLQKKKRRAPAPPPPQQPPPSPVVPNRKEDKEENRKSTVGVGRQVPQKPPRGTARGPPQLVLPPPPPYPPPDTDVTEPVTFPGEGAGSETSELRPKLSLPLGPGSHCSMGGVSQVPAESEETASEDTTEDSGVMSSPSDAISLDSQQDSMRSKDKWSTDQEDGSDQDLAGTPELGPQKSPSWGKSGSGSSILRTEKATMPTNDDEDLFITGHLHQTLAELDEDLEGMEENYETDTSSLTNSVNGVSNHSLQEAIIPDSGVDDIPVTFIGEVSDEPFDSGLFSSRCNNATTFNTGSIASQRSHLSPSQTEHSQPFVRTSRKEPDPSPPSQDNRKRNQPTLANTSENENPVETDPTVTSLVSKLLIDDPKAKDKGKVHGSSHSEKTQAGHGINSLRVNPRDGKDESSNSAPPPWSHHGQALGGSYGLKYGLTTYKIVPPKSEMRCYDRDVSLSTGAIKIDELGNLVSPHMNGSRTISPPSAVVETDTPPIGKVKEFWRRNSMEKYLNGPAECTIKRAPSTTITATPEKPQQDNGMKAAFTVTTPQQQPASQEYGAHLEEERSRPQSAVSCSVKVPASNPTDITFLKPQRRTSSQYVASAIAKKMGPPKVHADVVRPHKATTEQCHEEAKLARSPPTRKDDAAPNLHSEARQHEHGTNQSSVCLPSNPGVQLPAGGHPKVEVNSTYGKSSTQDYPAAVHRNSYFLPGRSSHRDRVSVGQSCGFNEKQTTSNQKANSTSNFSQALDKAHPPPLLLAEARDSGRILMNGSARTPGNCEPPHSPKESTLTSYIILQTEEKPSSLSTDGQDADDTLPSSIFGPKKKFKPVIQRPLPKDVSLHSALMEAIHSSGGREKLRKTAEQTSEGRPKKPSYVEAESERSALLAAIRGHSGTLSLRKVSSLASEELQSFRNAALGAPGLDKPQQEDLGLPPPPALPPPPAPAPQAPSASVTVSRFSTGTPSNSVNARQALMDAIRSGTGAARLRKVPLLV F4A8D3250294A277 pacsin1-cobl-1 4 Cobl 12 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Syndapin I 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9Z0W5:p.Pro434Leu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P L Tue Jul 12 10:06:18 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:48:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro434leu' Tue Jun 30 19:01:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro434Leu' physical association physical association domino mint f1d f1j f1g pacsin2-cobl 4 Syndapin II 11 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Cobl 12 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association domino mint f1j pacsin3-cobl 4 Syndapin III 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Cobl 12 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association domino mint f1j pacsin1-cobl-1 4 Syndapin I 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Cobl 12 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association f5d domino mint pacsin1-cobl-1 4 Syndapin I 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Cobl 12 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association f5d domino mint pacsin1-cobl-1 4 Syndapin I 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Cobl 12 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction domino mint f5o pacsin1-cobl-1 4 Cobl 12 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Syndapin I 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction domino mint f5o pacsin1-cobl-1 4 Syndapin I 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Cobl 12 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction domino mint f5o cobl-pacsin1-3 4 Syndapin I 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level Cobl 12 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association mint f5r pacsin2-cobl-1 4 Cobl 12 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Syndapin II 11 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association domino mint sf2d pacsin1-cobl-1 6 Syndapin I 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Cobl 12 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2d domino mint pacsin1-cobl-1 6 Syndapin I 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Cobl 12 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association domino mint f5h pacsin1-cobl-1 6 Syndapin I 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Cobl 12 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association domino mint f5h pacsin1-cobl-1 1 Cobl 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Syndapin I 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association mint f2h cobl-pacsin1-4 1 Cobl 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Syndapin I 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level N-WASP 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association homomint mint f8o cobl-pacsin1-5 3 Cobl 9 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell Syndapin I 10 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization f3c mint cobl-pacsin1-6 3 Cobl 9 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell Syndapin I 10 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization f3f mint cobl-pacsin1-7 2 Syndapin I 10 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Cobl 12 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f5 mint cobl-pacsin1-8 2 Syndapin I 10 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Cobl 12 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f5 mint cobl-pacsin2 2 Syndapin II 11 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Cobl 12 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint f5u cobl-pacsin2-1 2 Syndapin II 11 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Cobl 12 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association mint f5u cobl-pacsin3 2 Syndapin III 8 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Cobl 12 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint f5v cobl-pacsin3-1 2 Syndapin III 8 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Cobl 12 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint f5v cobl-pacsin1-9 5 Cobl 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Syndapin I 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization mint f7o f7p