IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The INAD Scaffold Is a Dynamic, Redox-Regulated Modulator of Signaling in the Drosophila Eye. The INAD Scaffold Is a Dynamic, Redox-Regulated Modulator of Signaling in the Drosophila Eye. Cell (0092-8674) 2011 imex curation Liu W., Wen W., Wei Z., Yu J., Ye F., Liu C.H., Hardie R.C., Zhang M. mzhang@ust.hk 23-Sept-2011: Contacted by JYOTI. mgt Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Liu W., Wen W., Wei Z., Yu J., Ye F., Liu C.H., Hardie R.C., Zhang M. no uniprot-dr-export has been set to no as species are too evolutionary disparate for an export to make sense. mzhang@ust.hk Accepted 2011-AUG-30 by MGT 23-Sept-2011: Contacted by JYOTI. Cell (0092-8674) 2011 mgt Only protein-protein interactions imex curation Figs 5F and G added to EBI-4307022, comment added to reflect additional information. new interaction EBI-4373471 added for S6C The INAD Scaffold Is a Dynamic, Redox-Regulated Modulator of Signaling in the Drosophila Eye. The INAD Scaffold Is a Dynamic, Redox-Regulated Modulator of Signaling in the Drosophila Eye. Cell (0092-8674) 2011 imex curation Liu W., Wen W., Wei Z., Yu J., Ye F., Liu C.H., Hardie R.C., Zhang M. mzhang@ust.hk 23-Sept-2011: Contacted by JYOTI. mgt Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Liu W., Wen W., Wei Z., Yu J., Ye F., Liu C.H., Hardie R.C., Zhang M. mzhang@ust.hk Accepted 2011-AUG-30 by MGT 23-Sept-2011: Contacted by JYOTI. Cell (0092-8674) 2011 mgt Only protein-protein interactions imex curation Figs 5F and G added to EBI-4307022, comment added to reflect additional information. new interaction EBI-4373471 added for S6C The INAD Scaffold Is a Dynamic, Redox-Regulated Modulator of Signaling in the Drosophila Eye. The INAD Scaffold Is a Dynamic, Redox-Regulated Modulator of Signaling in the Drosophila Eye. Cell (0092-8674) 2011 imex curation Liu W., Wen W., Wei Z., Yu J., Ye F., Liu C.H., Hardie R.C., Zhang M. mzhang@ust.hk 23-Sept-2011: Contacted by JYOTI. mgt Only protein-protein interactions in vitro In vitro peptide array peptide array predetermined predetermined participant predetermined Liu W., Wen W., Wei Z., Yu J., Ye F., Liu C.H., Hardie R.C., Zhang M. no uniprot-dr-export has been set to no as species are too evolutionary disparate for an export to make sense. mzhang@ust.hk Accepted 2011-AUG-30 by MGT 23-Sept-2011: Contacted by JYOTI. Cell (0092-8674) 2011 mgt Only protein-protein interactions imex curation Figs 5F and G added to EBI-4307022, comment added to reflect additional information. new interaction EBI-4373471 added for S6C The INAD Scaffold Is a Dynamic, Redox-Regulated Modulator of Signaling in the Drosophila Eye. The INAD Scaffold Is a Dynamic, Redox-Regulated Modulator of Signaling in the Drosophila Eye. Cell (0092-8674) 2011 imex curation Liu W., Wen W., Wei Z., Yu J., Ye F., Liu C.H., Hardie R.C., Zhang M. mzhang@ust.hk 23-Sept-2011: Contacted by JYOTI. mgt Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Liu W., Wen W., Wei Z., Yu J., Ye F., Liu C.H., Hardie R.C., Zhang M. no Cannot find crystal in PDB and there is no accession no. in manuscript. mzhang@ust.hk Accepted 2011-AUG-30 by MGT 23-Sept-2011: Contacted by JYOTI. Cell (0092-8674) 2011 mgt Only protein-protein interactions imex curation Figs 5F and G added to EBI-4307022, comment added to reflect additional information. new interaction EBI-4373471 added for S6C The INAD Scaffold Is a Dynamic, Redox-Regulated Modulator of Signaling in the Drosophila Eye. The INAD Scaffold Is a Dynamic, Redox-Regulated Modulator of Signaling in the Drosophila Eye. Cell (0092-8674) 2011 imex curation Liu W., Wen W., Wei Z., Yu J., Ye F., Liu C.H., Hardie R.C., Zhang M. mzhang@ust.hk 23-Sept-2011: Contacted by JYOTI. mgt Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Liu W., Wen W., Wei Z., Yu J., Ye F., Liu C.H., Hardie R.C., Zhang M. mzhang@ust.hk Accepted 2011-AUG-30 by MGT 23-Sept-2011: Contacted by JYOTI. Cell (0092-8674) 2011 mgt Only protein-protein interactions imex curation Figs 5F and G added to EBI-4307022, comment added to reflect additional information. new interaction EBI-4373471 added for S6C The INAD Scaffold Is a Dynamic, Redox-Regulated Modulator of Signaling in the Drosophila Eye. The INAD Scaffold Is a Dynamic, Redox-Regulated Modulator of Signaling in the Drosophila Eye. Cell (0092-8674) 2011 imex curation Liu W., Wen W., Wei Z., Yu J., Ye F., Liu C.H., Hardie R.C., Zhang M. mzhang@ust.hk 23-Sept-2011: Contacted by JYOTI. mgt Only protein-protein interactions in vitro In vitro peptide array peptide array predetermined predetermined participant predetermined Liu W., Wen W., Wei Z., Yu J., Ye F., Liu C.H., Hardie R.C., Zhang M. mzhang@ust.hk Accepted 2011-AUG-30 by MGT 23-Sept-2011: Contacted by JYOTI. Cell (0092-8674) 2011 mgt Only protein-protein interactions imex curation Figs 5F and G added to EBI-4307022, comment added to reflect additional information. new interaction EBI-4373471 added for S6C The INAD Scaffold Is a Dynamic, Redox-Regulated Modulator of Signaling in the Drosophila Eye. The INAD Scaffold Is a Dynamic, Redox-Regulated Modulator of Signaling in the Drosophila Eye. Cell (0092-8674) 2011 imex curation Liu W., Wen W., Wei Z., Yu J., Ye F., Liu C.H., Hardie R.C., Zhang M. mzhang@ust.hk 23-Sept-2011: Contacted by JYOTI. mgt Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Liu W., Wen W., Wei Z., Yu J., Ye F., Liu C.H., Hardie R.C., Zhang M. mzhang@ust.hk Accepted 2011-AUG-30 by MGT 23-Sept-2011: Contacted by JYOTI. Cell (0092-8674) 2011 mgt Only protein-protein interactions imex curation Figs 5F and G added to EBI-4307022, comment added to reflect additional information. new interaction EBI-4373471 added for S6C The INAD Scaffold Is a Dynamic, Redox-Regulated Modulator of Signaling in the Drosophila Eye. The INAD Scaffold Is a Dynamic, Redox-Regulated Modulator of Signaling in the Drosophila Eye. Cell (0092-8674) 2011 imex curation Liu W., Wen W., Wei Z., Yu J., Ye F., Liu C.H., Hardie R.C., Zhang M. mzhang@ust.hk 23-Sept-2011: Contacted by JYOTI. mgt Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Liu W., Wen W., Wei Z., Yu J., Ye F., Liu C.H., Hardie R.C., Zhang M. mzhang@ust.hk Accepted 2011-AUG-30 by MGT 23-Sept-2011: Contacted by JYOTI. Cell (0092-8674) 2011 mgt Only protein-protein interactions imex curation Figs 5F and G added to EBI-4307022, comment added to reflect additional information. new interaction EBI-4373471 added for S6C The INAD Scaffold Is a Dynamic, Redox-Regulated Modulator of Signaling in the Drosophila Eye. The INAD Scaffold Is a Dynamic, Redox-Regulated Modulator of Signaling in the Drosophila Eye. Cell (0092-8674) 2011 imex curation Liu W., Wen W., Wei Z., Yu J., Ye F., Liu C.H., Hardie R.C., Zhang M. mzhang@ust.hk 23-Sept-2011: Contacted by JYOTI. mgt Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Liu W., Wen W., Wei Z., Yu J., Ye F., Liu C.H., Hardie R.C., Zhang M. mzhang@ust.hk Accepted 2011-AUG-30 by MGT 23-Sept-2011: Contacted by JYOTI. Cell (0092-8674) 2011 mgt Only protein-protein interactions imex curation Figs 5F and G added to EBI-4307022, comment added to reflect additional information. new interaction EBI-4373471 added for S6C The INAD Scaffold Is a Dynamic, Redox-Regulated Modulator of Signaling in the Drosophila Eye. The INAD Scaffold Is a Dynamic, Redox-Regulated Modulator of Signaling in the Drosophila Eye. Cell (0092-8674) 2011 imex curation Liu W., Wen W., Wei Z., Yu J., Ye F., Liu C.H., Hardie R.C., Zhang M. mzhang@ust.hk 23-Sept-2011: Contacted by JYOTI. mgt Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Liu W., Wen W., Wei Z., Yu J., Ye F., Liu C.H., Hardie R.C., Zhang M. mzhang@ust.hk Accepted 2011-AUG-30 by MGT 23-Sept-2011: Contacted by JYOTI. Cell (0092-8674) 2011 mgt Only protein-protein interactions imex curation Figs 5F and G added to EBI-4307022, comment added to reflect additional information. new interaction EBI-4373471 added for S6C nrx1a_rat Neurexin-1 Nrxn1 Neurexin I-alpha Neurexin-1-alpha protein protein rat Rattus norvegicus (Rat) Rat MGTALVQHGGCCLLCLSLLLLGCWAELGSGLEFPGAEGQWTRFPKWNACCESEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLYIDRAEAKWVEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQALPVDGSEVKLDEEPPNSGGGSPCEAGDEGDGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKEDNNVEGLAHLMMGDQGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQHSGIGHAMVNKLHCSVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEIQSTAGVKPSCSRETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKIDTKITTQITAGARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLPDLISDALFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITHKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMTTESTATAMQSEMSTSIMETTTTLATSTARRGKPPTKEPISQTTDDILVASAECPSDDEDIDPCEPSSGGLANPTRVGGREPYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYISNSAQSNGAVVKEKQPSSAKSANKNKKNKDKEYYV 548109BAF05119FC a3rlx3_drome Kon protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSRLRGLGFGWLWLAWLAILQLQTVAAMKVSLFGDGYVSMPLQEAKMSTNIRVKFRTRQENAFLFLAAGRTDYCLLRLESGLISFSYKIERDVVQLRSPKKQKLNDLEWHDVAVQRFENNITLQVDGYIMRKQLPGDLAALNIHFGTFLGGVGDFTAEFLDDVIGFRGCISDVFYNNINIIKRAKDRTSHTTSTGVAWTCSTEFEGSIQDSISFMRNDSYSLMMKESYAMGETLSLQFRTMASAGVIFFNGGFDFILLEIEDQHLKVTFNKAGSLVQFMTNEHISDGKWHRVFLRYNAAIAELILDDATSGYRGTHANETKASINLEKSVFFGGVQEEMRRRLISKGLRINEISFKGCMRDILVNDLPLGFAEMTISRSLALNCLWKYPCVEYNPCLKSGICSQHGVDGFICYCDQSYCIKADFQGPFKIFTETSPELELLYVSPMQLLEGGTAFLSPHFIDIILDLRRYPSLNEQSIIFHVVHQPKYGQLLQYSAEKAIFVPCRTFNLVDLATDKLKYVHNGQENFNDHATLDMQIFGDVHKIPDNILGKHRFLLHANITPINDPPQLRLHSHKILRVIEGIERVLDVDLFNIDDPDSEPGNLIYTILPTQSPQETFGCFIVGGATTSAFSQAEVNVGKVSYLYNSTTAESFSYELQLQVSDGIETSETVYLPVSVHPLELRLVNNTGLIMIHKSSLPISTANLSIGTNAVDDHIDIRYDIVKAPQHGVLQRLRQIDGSWVNVDWFSDSQLLLGHIRYLHSSDFPWQDEFKFIASFGFVTTQTFDFRITFTRLRITSTRPSQISINGSREILLTSDVLSYETTPIGSFARSVIYKITKPTRYGGIYVEGSRKAAKKLDSFTQQDIEKRRIRYQTHHTSYSSFSDHLEFVVSVAECDDVAGVLEINYRPPDELINKLGYQNHEPLQVQEGERALITKNHFGIRFNIYESLQFQVSLSPEHGVICKYDEQTGLTTPVEMFTLEQLFRNDIYYCHDDTESTRDTFELLILSGDETDLQFVSNMEVHIKLVNDNEPYRTAIERVFHVVRNGIRTLNPTVLQYLDADVNTNHTDIHYIHVSSTNGAFYKSGHYIDSFTQDDIANRRIMFQHTGADSGTASFIVTDREHEVNGLLEIRASDPFVSMMATNASIVQEGKFVVLKNKDFILETNLDMKLDEIYYEVIKPPSYGILMYLSRANEGENGTTIYKATNYTSLSNFTHLDIERERLVYWNTEIASMDKVRYRVHIKNITAEGEVMFRIYPSAYWEPLQVKQNHTLYVEESTSVLISRDVLEVVHPNISPGDITFLVTSSPMHGYLEMQSMSFDDEYNCKVFDQSSVNTEKMFYIQAGVNQSTDYFVFDVTNGITWLRQLMIKIVIIPEKLYMHSNIISVVEGKTVQLNPTDIQPYSEYYRGKILEYIVTITPSSGHVLAGNSKVKRFTQKQLEQGSIQYVHNGSENATDSITLVAMARNKESVPFELEFAVVQVNDEEPMMVTNTGLQVWNGGRYVIKNTDLLAQDYDTPPENLTFVVNHIYGGYLARKSAPHQKIEHFTQAQINLEEIYFMHDSNSRRNELSFVVTDGLFNTTTQMLNIEIKPIEILAEHNENLHVFPLTKKQILRDYLHFKCSDEEREIRYNITVPPSLGRIVNEFIDNGFTKEVSEFTQNDVDNGHIFYEHTAVIMEFRTNDSFYFDVVAERSDRLLNQKFNIEISVSSGGLLRFLPVNKLNVDEGGSVPIKLDFSKILEYLKTKAGINNPELFIEAIQKPTHGNIGLGHEFKHMQRYHPSDFFTKKVYYIHDHSDTLEDTILMSVYLTQGNIFLCNLTIPVSINPINDQPFHLVTHLPQMTVVEGENRTITRNDLLTEDADTPPEEIIYDVMSGPTLGVLRKITNDGRPEDLLAFSNQFTQADINNDRIIYVHFGMPQSTTFCFTVSDGQSNPAYEIFTIKIDSIHLQPSAMQAPVKVQQGATTAPMRLDHIGVSTNVHMERLSYNVTNSPLFGIIVYKHQPTLRFTQQQLETSQISYMQTDLNRSNDSFQVSAYVPGTNYVAQVDVVMEVEPVIQINDIVMKEAESSGGKIKLITSLDNDNPLSLKLNKFNPKFVITRMPSTGQIRKIIRSTGLTTDGQSDRSTNIFSYKELRSGVVYFVPHESVEETEADHDSFDYQLLIKTVQPAQATVSIEYRSRVEETETVHLGSAGLSINYLAIGCAIFIVLICLLIVLLILKIRKLRKHKADISKDQPPALPCPPDLTSVSPQHHLHHHHGHHYASSEADSVPATGNSTPLPGFSNIPHCKIIPVESYKHEYPDYDPDEEETDDQCDPQQMMLPQRYNPYHMEHDAWSSSCDMANDFAGYASVPQSISGSVSSPPSAPPTNPLLRRNQYWV 2FCE5482EC821720 jam1_rat Junctional adhesion molecule A F11r Jam1 Junctional adhesion molecule 1 protein protein rat Rattus norvegicus (Rat) Rat MGTEGKAGSKLLFLFTSMILGSLVQGKGSVYSPQTAVQVPENDSVKLPCIYSGFSSPRVEWKFVQGSTTALVCYNNQITVPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEDGGQNYGEVSIHLTVLVPPSKPTVSIPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGVPMLTADAKKTRAFINSSYTIDPKSGDLVFDPVSAFDSGEYYCEAQNGYGTAMRSEAVRMEAVELNVGGIVAAVLVTLILLGLLIFGIWFAYSRGYFERTKKGTAPGKKVIYSQPSARSEGEFKQTSSFLV 45AE362A96158BFA inad_drome Inactivation-no-after-potential D protein inaD CG3504 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MVQFLGKQGTAGELIHMVTLDKTGKKSFGICIVRGEVKDSPNTKTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQTFDKSDEQQAKSDPRSNGYMQAKNKFNQEQTTNNNASGGQGMGQGQGQGQGMAGMNRQQSMQKRNTTFTASMRQKHSNYADEDDEDTRDMTGRIRTEAGYEIDRASAGNCKLNKQEKDRDKEQEDEFGYTMAKINKRYNMMKDLRRIEVQRDASKPLGLALAGHKDRQKMACFVAGVDPNGALGSVDIKPGDEIVEVNGNVLKNRCHLNASAVFKNVDGDKLVMITSRRKPNDEGMCVKPIKKFPTASDETKFIFDQFPKARTVQVRKEGFLGIMVIYGKHAEVGSGIFISDLREGSNAELAGVKVGDMLLAVNQDVTLESNYDDATGLLKRAEGVVTMILLTLKSEEAIKAEKAAEEKKKEEAKKEEEKPQEPATAEIKPNKKILIELKVEKKPMGVIVCGGKNNHVTTGCVITHVYPEGQVAADKRLKIFDHICDINGTPIHVGSMTTLKVHQLFHTTYEKAVTLTVFRADPPELEKFNVDLMKKAGKELGLSLSPNEIGCTIADLIQGQYPEIDSKLQRGDIITKFNGDALEGLPFQVCYALFKGANGKVSMEVTRPKPTLRTEAPKA DIP protein Q24008 original sequence version: 68 DIP protein Q24008 original sequence version: 131 D4C24091D99EA7F3 cspg4_rat Chondroitin sulfate proteoglycan 4 Cspg4 Ng2 Chondroitin sulfate proteoglycan NG2 HSN tumor-specific antigen protein protein rat Rattus norvegicus (Rat) Rat MLLSPGHPLSAPALALILTLALLVRSTAPASFFGENHLEVPVPSALTRVDLLLQFSTSQPEALLLLAAGQTDHLLLQLQSGHLQVRLALGQNELSLQTPADTVLSDSTTHTVVLTVSNSWAVLSVDGVLNTSAPIPKASHLKVPYGLFVGSSGSLDLPYLKGISRPLRGCLHSAILNGRNLLRPLTPDVHEGCAEEFSAGDEVGLGFSGPHSLAAFPAWSTREEGTLEFTLTTRSQQAPLAFQAGDKRGNFIYVDIFEGHLRAVVEKGQGTMLLRNSVPVADGQPHEVSVHIDVHRLEISVDQYPTRTFNRGVLSYLEPRGSLLLGGLDTEASRHLQEHRLGLTPGAANISLVGCIEDFSVNGRRLGLRDAWLTRDMAAGCRPEEDEYEEEVYGPFEAFSTLAPEAWPVMDLPEPCVPEPGLPAVFANFTQLLTISPLVVAEGGTAWLEWRHVQPTLDLTEAELRKSQVLFSVSQGARHGELELDIPGAQTRKMFTLLDVVNRKARFVHDGSEDTSDQLMLEVSVTSRAPVPSCLRRGQIYILPIQVNPVNDPPRIVFPHGSLMVILEHTQKPLGPEIFQAYDPDSACEGLTIQLLGVSASVPVEHRDQPGEPVTEFSCRDLEAGNIVYVHRGGPAQDLTFRVSDGMQASGPATLKVVAVRPAIQILHNTGLRLAQGSAAAILPANLSVETNAVGQDVSVLFRVTGTLQFGELQKQGAGGVEGTEWWDTLAFHQRDVEQGRVRYLSTDPQHHTQDTVEDLTLEVQVGQETLSNLSFPVTIQRATVWMLQLEPLHTQNPHQETLTSAHLEASLEEEGEGGPYPHIFHYELVQAPRRGNLLLQGTRLSDGQSFSQSDLQAGRVTYRATTRTSEAAEDSFRFRVTSPPHFSPLYTFPIHIGGDPNAPVLTNVLLMVPEGGEGVLSADHLFVKSLNSASYLYEVMEQPHHGSLAWRDPKGRATPVTSFTNEDLLHGRLVYQHDDSETIEDDIPFVATRQGEGSGDMAWEEVRGVFRVAIQPVNDHAPVQTISRVFHVARGGQRLLTTDDVAFSDADSGFSDAQLVLTRKDLLFGSIVAMEEPTRPIYRFTQEDLRKKQVLFVHSGADHGWLQLQVSDGQHQATAMLEVQASEPYLHVANSSSLVVPQGGQGTIDTAVLHLDTNLDIRSGNEVHYHVTAGPHWGQLLRDGQSVTSFSQRDLLDGAILYSHNGSLSPQDTLALSVAAGPVHTSTVLQVTIALEGPLAPLQLVQHKRIYVFQGEAAEIRRDQLEVVQEAVLPADIMFSLRSPPNAGYLVMVSHGASADGPPSLDPVQRFSQEAINSGRVLYLHSRPGAWSDSFSLDVASGLGDPLEGISVELEVLPTVIPLDVQNFSVPEGGTRTLAPPLIQITGPYLGTLPGLVLQVLEPPQHGALQKEDRPQDGTLSTFSWREVEEQLIRYVHDGSETQTDGFILLANASEMDRQSQPMAFTITILPVNDQPPVITTNTGLQIWEGAIVPIPPEALRGIDSDSGPEDLVYTIEQPSNGRIALRVAPDAEAHRFTQAQLDSGLVLFSHRGALEGGFHFDLSDGVHTSPGHFFRVVAQKQVLLSLEGSRKLTVCPESVQPLSSQSLSASSSTGSDPRHLLYQVVRGPQLGRLLHAQQGSAEEALVNFTQAEVNAGNILYEHEISSEPFWEAHDTIGLLLSSSPARDLAATLAVTVSFDAACPQRPSRLWRNKGLWVPEGQRAKITVAALDAANLLASVPASQRGRHDVLFQITQFPTRGQLLVSEEPLHARRPHFLQSELTAGQLVYAHGGGGTQQDGFRFRAHLQGPTGASVAGPQTSEAFVITVRDVNERPPQPQASIPLRITRGSRAPVSRAQLSVVDPDSAPGEIEYEVQRAPHNGFLSLAGDNTGPVTHFTQADVDAGRLAFVANGSSVAGVFQLSMSDGASPPIPMSLAVDVLPSTIEVQLRAPLEVPQALGRSSLSRQQLQVISDREEPDVAYRLTQGPLYGQVLVGGQPASAFSQLQVDQGDVVFAFTNFSSSQDHFKVLALARGVNASATVNVTVQALLHVWAGGPWPQGTTLRLDPTVLDASELANRTGSMPRFRLLEGPRYGRVVRVSQGRAESRTNQLVEDFTQQDLEEGRLGLEVGRPEGRSTGPTGDRLTLELQATGVPPAVALLDFATEPYHAAKFYKVTLLSVPEAARTETEKTGKSTPTGQPGQAASSPMPTVAKSGFLGFLEANMFSVIIPVCLVLLLLALILPLLFYLRKRNKTGKHDVQVLTAKPRNGLAGDTETFRKVEPGQAIPLTTVPGQGPPPGGQPDPELLQFCRTPNPALRNGQYWV FA3E3BCEDB7E5EF5 kpc2_drome Protein kinase C, eye isozyme inaC PKC2 CG6518 Eye-PKC Photoreceptor-specific PKC dPKC53E(EY) Inactivation no after-potential C protein protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAAAAVATPGATVLPPSVPSAAPGAKAPAAGAGKGPGNLLEITGEANIVNYMKNRLRKGAMKRKGLEMVNGHRFGVRFFKNPTYCGHCKDFIWGFGKQGFQCEECRFNIHQKCCKFVVFKCPGKDTDFDADCAKVKHGWISTTYTTPTFCDECGLLLHGVAHQGVKCENCNLNVHHACQETVPPMCGADISEVRGKLLLYVELKGNNLKVDIKEAANLIPMDTNGFSDPYIAVQMHPDRSGRTKKKTKTIQKNLNPVFNETFTFELQPQDRDKRLLIEVWDWDRTSRNDFMGSFSFSLEELQKEPVDGWYKFLSQVEGEHYNIPCVDAFNDIARLRDEVRHDRRPNEKRRMDNKDMPHNMSKRDMIRAADFNFVKVIGKGSFGKVLLAERRGTDELYAVKVLRKDVIIQTDDMELPMNEKKILALSGRPPFLVSMHSCFQTMDRLFFVMEYCKGGDLMYHMQQYGRFKESVAIFYAVEVAIALFFLHERDIIYRDLKLDNILLDGEGHVKLVDFGLSKEGVTERQTTRTFCGTPNYMAPEIVSYDPYSIAADWWSFGVLLFEFMAGQAPFEGDDETTVFRNIKDKKAVFPKHFSVEAMDIITSFLTKKPNNRLGAGRYARQEITTHPFFRNVDWDKAEACEMEPPIKPMIKHRKDISNFDDAFTKEKTDLTPTDKLFMMNLDQNDFIGFSFMNPEFITII DIP protein P13677 original sequence version: 133 41B6BFF7FF3F6F8F trp_drome Transient receptor potential protein trp CG7875 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MGSNTESDAEKALGSRLDYDLMMAEEYILSDVEKNFILSCERGDLPGVKKILEEYQGTDKFNINCTDPMNRSALISAIENENFDLMVILLEHNIEVGDALLHAISEEYVEAVEELLQWEETNHKEGQPYSWEAVDRSKSTFTVDITPLILAAHRNNYEILKILLDRGATLPMPHDVKCGCDECVTSQMTDSLRHSQSRINAYRALSASSLIALSSRDPVLTAFQLSWELKRLQAMESEFRAEYTEMRQMVQDFGTSLLDHARTSMELEVMLNFNHEPSHDIWCLGQRQTLERLKLAIRYKQKTFVAHPNVQQLLAAIWYDGLPGFRRKQASQQLMDVVKLGCSFPIYSLKYILAPDSEGAKFMRKPFVKFITHSCSYMFFLMLLGAASLRVVQITFELLAFPWMLTMLEDWRKHERGSLPGPIELAIITYIMALIFEELKSLYSDGLFEYIMDLWNIVDYISNMFYVTWILCRATAWVIVHRDLWFRGIDPYFPREHWHPFDPMLLSEGAFAAGMVFSYLKLVHIFSINPHLGPLQVSLGRMIIDIIKFFFIYTLVLFAFGCGLNQLLWYYAELEKNKCYHLHPDVADFDDQEKACTIWRRFSNLFETSQSLFWASFGLVDLVSFDLAGIKSFTRFWALLMFGSYSVINIIVLLNMLIAMMSNSYQIISERADTEWKFARSQLWMSYFEDGGTIPPPFNLCPNMKMLRKTLGRKRPSRTKSFMRKSMERAQTLHDKVMKLLVRRYITAEQRRRDDYGITEDDIIEVRQDISSLRFELLEIFTNNNWDVPDIEKKSQGVARTTKGKVMERRILKDFQIGFVENLKQEMSESESGRDIFSSLAKVIGRKKTQKGDKDWNAIARKNTFASDPIGSKRSSMQRHSQRSLRRKIIEQANEGLQMNQTQLIEFNPNLGDVTRATRVAYVKFMRKKMAADEVSLADDEGAPNGEGEKKPLDASGSKKSITSGGTGGGASMLAAAALRASVKNVDEKSGADGKPGTMGKPTDDKKAGDDKDKQQPPKDSKPSAGGPKPGDQKPTPGAGAPKPQAAGTISKPGESQKKDAPAPPTKPGDTKPAAPKPGESAKPEAAAKKEESSKTEASKPAATNGAAKSAAPSAPSDAKPDSKLKPGAAGAPEATKATNGASKPDEKKSGPEEPKKAAGDSKPGDDAKDKDKKPGDDKDKKPGDDKDKKPADNNDKKPADDKDKKPGDDKDKKPGDDKDKKPSDDKDKKPADDKDKKPAAAPLKPAIKVGQSSAAAGGERGKSTVTGRMISGWL DIP protein P19334 original sequence version: 154 4376C1B853868B4C pipa_drome 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase norpA Phosphoinositide phospholipase C No receptor potential A protein 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta PLC-beta Phosphoinositide phospholipase C-beta CG3620 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MTKKYEFDWIIPVPPELTTGCVFDRWFENEKETKENDFERDALFKVDEYGFFLYWKSEGRDGDVIELCQVSDIRAGGTPKDPKILDKVTKKNGTNIPELDKRSLTICSNTDYINITYHHVICPDAATAKSWQKNLRLITHNNRATNVCPRVNLMKHWMRLSYCVEKSGKIPVKTLAKTFASGKTEKLVYTCIKDAGLPDDKNATMTKEQFTFDKFYALYHKVCPRNDIEELFTSITKGKQDFISLEQFIQFMNDKQRDPRMNEILYPLYEEKRCTEIINDYELDEEKKKNVQMSLDGFKRYLMSDENAPVFLDRLDFYMEMDQPLAHYYINSSHNTYLSGRQIGGKSSVEMYRQTLLAGCRCVELDCWNGKGEDEEPIVTHGHAYCTEILFKDCIQAIADCAFVSSEYPVILSFENHCNRAQQYKLAKYCDDFFGDLLLKEPLPDHPLDPGLPLPPPCKLKRKILIKNKRMKPEVEKVELELWLKGELKTDDDPEEDASAGKPPEAAAAPAPAPEAAAAAEGAAEGGGGAEAEAAAANYSGSTTNVHPWLSSMVNYAQPIKFQGFDKAIEKNIAHNMSSFAESAGMNYLKQSSIDFVNYNKRQMSRIYPKGTRADSSNYMPQVFWNAGCQMVSLNFQSSDLPMQLNQGKFEYNGGCGYLLKPDFMRRADKDFDPFADAPVDGVIAAQCSVKVIAGQFLSDKKVGTYVEVDMFGLPSDTVKKEFRTRLVANNGLNPVYNEDPFVFRKVVLPDLAVLRFGVYEESGKILGQRILPLDGLQAGYRHVSLRTEANFPMSLPMLFVNIELKIYVPDGFEDFMAMLSDPRGFAGAAKQQNEQMKALGIEEQSGGAARDAGKAKEEEKKEPPLVFEPVTLESLRQEKGFQKVGKKQIKELDTLRKKHAKERTSVQKTQNAAIDKLIKGKSKDDIRNDANIKNSINDQTKQWTDMIARHRKEEWDMLRQHVQDSQDAMKALMLTVQAAQIKQLEDRHARDIKDLNAKQAKMSADTAKEVQNDKTLKTKNEKDRRLREKRQNNVKRFMEEKKQIGVKQGRAMEKLKLAHSKQIEEFSTDVQKLMDMYKIEEEAYKTQGKTEFYA DIP protein P13217 original sequence version: 176 CC712ABF9B065BB6 q9w2s5_drome X11Lbeta CG1852 CG1861 Dmel\CG32677 Dmint2 X11B x11Lbeta Dmel_CG32677 CG32677 X11LB X11lbeta protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MVSTTLTTLAAGQTTSSSNHHHHHHHSHQQQQQQQQQDQSQQQPHQQLPYQQRGYYALNGSLELDCDTSNTNSSSSSNNIGYQQHQQQQQQQQQPPLILSQALLSPSPPLNDQISLLFPKCRPKQQQQQQQQQQQQQQQQQQQLQPAQQHQQHVHPTDVNSSCNSNRSSSPTTAGAVGEPLASVSVSPPPPKATPTSSTPSYYKSVNIITQSPPPHSASSHSSESLSSVTPRISTNPFLCAPLTPPTPPHHHHHHHHQQQHQQKQQQPKQQHQTQQQEQQEEDTTGESVVEHSRSGAAGEVLEYPASFYYHTVGDSRRGPGSYTEMPRKRSSALPASNRQQQLHNGNGSQNPFIKENYWEAPPTRASLLLHSPTEYSEEPQQQQQIQQQQQQQQQQQQQQQQQQQQHLHASARRAYHQQREQVYGINQRPQQQQQQNILRVGRSPVNRSFPQQHQQQQQQQQQQQQQQQQQQQPHQQIPTARSNPCADGLTPLASHYLYGSKSSLDQHPGDWEPREQRKLRLREEREREREREREREREREREHLLLEQQQQLQLQEVQVARDNHLSHLAGQQQQQQQRKRHVYGEERERERDRERDMDRDHRLVNGNADPNESWQHLRVTTETLAEEGGKHGKPADKAQHQMHNTNQSQNSDVNVYREHQLDAWKLERSYTLAVESRHGIIEYEGSPRRIGVTTTSNLGATGAAAASAAADESEPPAAAEGAAAATATSQPQQQVPMATVPPLSSTATSLQKTAARAALAALAQSHPHSSHNILSTLLPHSPNPVNPGQMHAAQQSIQNYPVRPGFPQRIISPPSRDPRSSSPPLQQQQYQQQQQQQLQHQQQHFASLMSSHSNNNSNTNKQPLSSDNNAEDTSNDVSEIGTISDLTTPEAVGLSIGIAAGEMASRASTPPQTAQAPPTAVAGSTANGTGSGNGTATGNATAAGSGLGPLSLHTKSSTFDYLYEFSETRKVLEEFFKCPSTDEQPIMENGSDVDSIDIQYEFHSNFERDEEDLAEEEEAEDDEEVDDDADEENDEAEDEDEPLEQDRDQNYRAQAPPQSGHIDSERLVYSGYGQQPQLQAQLTAQPMSGARRHYSGSPLMRDFDFFLDSTSRSSGERDADQDGLNHNQLLSTSSGHGGGVGVSGGLGVGPGGGHNYRYSPETTDYDSNCGDLDSLSGEMNGGVSTSCSNYAKFYASAMPVLEDGLSSGHTSDTENNNNNQKNLQQSTVNQGGQCPTSLSGSTSIGGSGGISMLMDMKRISTNHSLNSMNNQTTTASTTTDSNGGVGGVGHHLVATLVASPNNEQAKSQCQTQLQSHPPKTLSLDQSPSNHSKVFKNIDPELDSLYSIGVFHRPDTVQMTPPPPAPAPHRKPNNNGCSSGVVNTNGSLAGGSNDVDLLQPSSKHTPLAAAISSTLQRSSPTSTITGNGIGNGSGKTRSAGSNCSSSANGGMPPPIPERTNLVSAVQRSPSPGPNSPVWLSRHLDGGAGKDLLESGSDNHSKNHSADEEDVDTDLETDRLLGHQRLDDQGYYDENKSWDRKPRSLLSKISPKQQIPSTKTRNGYNALLSSTPELPPPIPPKGQSGLGLGLTLGAGNGGKLLDLVGGMVQRSLSRSSSEHSEKSLSKMPISGGDLCAGGVDVVASTVAATSATVVASTPALGSPGNGGGSERSAAEMANPGGAVKLSEQEIGTINGGSVMPLGSGSGTGSGAGSGAGSGTGTNAAVVANSNANNNVGGGGGGGNNSSGSGAGSNSNSGEKKVKKSKSKEGGAVLIEGVLFRAKYLGSTQLVCEGQPTKSTRMMQAEEAVSRIKALAPDGDVQPSTEVDLFISTEKIMVLNTDLKEIMMDHALRTISYIADIGDLVVLMARRRFVPQDIDDAPKPNRTPKMICHVFESDEAQFIAQSIGQAFQVAYMEFLKANGIEDHRFVKEMDYQEVLNSQEIFGDELEIFAKKELQKEVVVPKAKGEILGVVIVESGWGSMLPTVVIANLMSSGAAARCGQLNIGDQLIAINGLSLVGLPLSTCQTYIKNTKNQTVVKFTVVPCAPVVEVKIKRPETKYQLGFSVQNGVICSLLRGGIAERGGVRVGHRIIEINNQSVVAVPHEKIVNLLATSVGEILMKTMPTSMFRLLTGQENPIYI 2B0076CBAB88F698 nect3_mouse Nectin-3 Nectin3 Nectin cell adhesion molecule 3 Poliovirus receptor-related protein 3 Pvrl3 protein protein mouse Mus musculus Mouse MARTPGPAPLCPGGGKAQLSSAFPPAAGLLLPAPTPPPLLLLLIPLLLFSRLCGALAGSIIVEPHVTAVWGKNVSLKCLIEVNETITQISWEKIHGKSTQTVAVHHPQYGFSVQGDYQGRVLFKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKGPDSLIDGGNETVAAVCVAATGKPVAQIDWEGDLGEMESSTTSFPNETATIVSQYKLFPTRFARGRRITCVVKHPALEKDIRYSFILDIQYAPEVSVTGYDGNWFVGRKGVNLKCNADANPPPFKSVWSRLDGQWPDGLLASDNTLHFVHPLTVNYSGVYVCKVSNSLGQRSDQKVIYISDPPTTTTLQPTVQWHSSPADVQDIATEHKKLPFPLSTLATLKDDTIGTIIASVVGGALFLVLVSILAGVFCYRRRRTFRGDYFAKNYIPPSDMQKESQIDVLHQDELDSYPDSVKKENKNPVNNLIRKDYLEEPEKTQWNNVENLTRFERPMDYYEDLKMGMKFVSDERYNESEDGLVSHVDGSVISRREWYV 5492C9ABB472F185 apba1_rat Amyloid-beta A4 precursor protein-binding family A member 1 Neuron-specific X11 protein Neuronal Munc18-1-interacting protein 1 Adapter protein X11alpha Apba1 Mint1 X11 protein protein rat Rattus norvegicus (Rat) Rat MNHLEGSAEVEVADEAPGGEVNESVEADLEHPEVEEEQQPSPPPPAGHAPEDHRAHPAPPPPPPPQEEEEERGECLARSASTESGFHNHTDTAEGDVLAAARDGYEAERAQDADDESAYAVQYRPEAEEYTEQAEAEHAEAAQRRALPNHLHFHSLEHEEAMNAAYSGYVYTHRLFHRAEDEPYAEPYADYGGLQEHVYEEIGDAPELEARDGLRLYERERDEAAAYRQEALGARLHHYDERSDGESDSPEKEAEFAPYPRMDSYEQEEDIDQIVAEVKQSMSSQSLDKAAEDMPEAEQDLERAPTPGGGHPDSPGLPAPAGQQQRVVGTPGGSEVGQRYSKEKRDAISLAIKDIKEAIEEVKTRTIRSPYTPDEPKEPIWVMRQDISPTRDCDDQRPVDGDSPSPGSSSPLGAESSITPLHPGDPTEASTNKESRKSLASFPTYVEVPGPCDPEDLIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAVSRIKTAQKLAKSRKKAPEGESQPMTEVDLFISTQRIKVLNADTQEPMMDHPLRTISYIADIGNIVVLMARRRMPRSNSQENVEASHPSQDAKRQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDLLNTQDMYNDDLIHFSKSENCKDVFIEKQKGEILGVVIVESGWGSILPTVIIANMMHGGPAEKSGKLNIGDQIMSINGTSLVGLPLSTCQSIIKGLKNQSRVKLNIVRCPPVTTVLIRRPDLRYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATPHEKIVHILSNAVGEIHMKTMPAAMYRLLTAQEQPVYI 57F6EEA458376CAD kpca_human Protein kinase C alpha type PRKCA PKCA PRKACA protein protein human Homo sapiens Human MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNMELRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSVCKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV 9EB157789A062349 kon-inad 6 12 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 14 unspecified role unspecified role prey prey pdz5 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 25 27 direct interaction direct interaction Fig. 1A cspg4-inad 3 15 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 14 unspecified role unspecified role prey prey pdz5 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 30 32 direct interaction direct interaction Fig. 1A nrxn1-inad 3 11 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 14 unspecified role unspecified role prey prey pdz5 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 35 37 direct interaction direct interaction Fig. 1A pvrl3-inad 3 14 unspecified role unspecified role prey prey pdz5 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 20 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 42 40 direct interaction direct interaction Fig. 1A f11r-inad 3 13 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 14 unspecified role unspecified role prey prey pdz5 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 1A apba1-inad 3 21 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 14 unspecified role unspecified role prey prey pdz5 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 1A x11lbeta-inad 6 19 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role prey prey pdz5 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 55 57 direct interaction direct interaction Fig. 1A inad-x11lbeta 8 14 unspecified role unspecified role neutral component neutral component pdz5 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 19 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction Fig. 1A inad-kon-1 8 12 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 14 unspecified role unspecified role neutral component neutral component pdz5 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Figs. 1A, 1B, 5F, 5G, Supp. Fig. 4A Binding is not affected by a change in pH from 7.5 to 5.8. apba1-inad-2 1 14 unspecified role unspecified role neutral component neutral component pdz5 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 21 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 72 70 direct interaction direct interaction Fig. 1A inad-nrxn1 1 11 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 14 unspecified role unspecified role neutral component neutral component pdz5 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 75 77 direct interaction direct interaction Fig. 1A inad-pvrl3 1 14 unspecified role unspecified role neutral component neutral component pdz5 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 20 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 82 80 direct interaction direct interaction Fig. 1A cspg4-inad-3 1 14 unspecified role unspecified role neutral component neutral component pdz5 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 85 87 direct interaction direct interaction Fig. 1A f11r-inad-2 1 13 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 14 unspecified role unspecified role neutral component neutral component pdz5 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 90 92 direct interaction direct interaction Fig. 1A cspg4-inad-2 4 14 unspecified role unspecified role prey prey pdz4_5 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 95 97 direct interaction direct interaction Supp. Table 2 2.6A Rworking=19.8% Rfree=26.3% inad-kon 5 14 unspecified role unspecified role neutral component neutral component pdz5 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role neutral component neutral component region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 100 103 direct interaction direct interaction Supp. Figs. 1, 4B inac-inad-2 2 16 enzyme enzyme neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 14 enzyme target enzyme target substrate substrate neutral component neutral component Q24008:p.Thr513Ala mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A Wed May 02 15:37:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr513ala' Tue Jun 30 16:06:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr513Ala' pdz4_5 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q24008:p.Thr669Ala mutation mutation certain certain sequence position certain certain certain sequence position certain T A Wed May 02 20:21:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr669ala' Tue Jun 30 16:05:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr669Ala' ecoli Escherichia coli (strain K12) direct interaction direct interaction Figs. 5A, 5B Wild type Inad was not phosphorylated by ePKC, however substitution of Thr669 with Ala, a mutation originally designed to mimic non-phosphorylated state of the residue, led to dramatically increased phosphorylation. Thr513Ala in the PDZ45 interface also led to an increase of its phosphorylation inad-trp-1 8 17 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 14 unspecified role unspecified role neutral component neutral component pdz4_5 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 6B inad-trp-1 5 14 unspecified role unspecified role neutral component neutral component pdz4_5 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 17 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Fig. 6C inad-trp-1 10 17 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain gb1 tag region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role neutral component neutral component pdz 3_4_5 region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 6F trp-inad-1 7 14 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 17 unspecified role unspecified role bait bait P19334:p.[Val1266Ala;Trp1274Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A certain certain sequence position certain certain certain sequence position certain V A Wed May 02 19:15:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val1266ala,trp1274ala' Tue Jun 30 16:30:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val1266Ala;Trp1274Ala]' P19334:p.Val1266Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain V A Wed May 02 16:55:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val1266ala' Tue Jun 30 15:51:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val1266Ala' region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 6D trp-inad-2 9 17 unspecified role unspecified role bait bait gb1 tag region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role prey prey trp 3_4_5 region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp Fig. 6A prkca-inad-1 2 22 enzyme enzyme neutral component neutral component 14 enzyme target enzyme target substrate substrate neutral component neutral component pdz2 region sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp. Fig. 5B prkca-inad 2 22 enzyme enzyme neutral component neutral component 14 enzyme target enzyme target substrate substrate neutral component neutral component pdz2_4_5 region sufficient to bind sufficient binding region sufficient to bind range range range range range range range range ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp. Fig. 5B inad-norpa 8 18 unspecified role unspecified role neutral component neutral component c-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 14 unspecified role unspecified role neutral component neutral component pdz4_5 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 149 151 direct interaction direct interaction Supp. Fig. 6C norpA will bind to the PDZ5 domain of inad but with a Kd=30uM. The oxidation of PDZ45 abolished its binding to the norpA peptide inac-1 2 16 putative self putative self putative self putative self region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection direct interaction direct interaction true Supp. Fig. 5C