MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The Sm-like RNA chaperone Hfq mediates transcription antitermination at Rho-dependent terminators. The Sm-like RNA chaperone Hfq mediates transcription antitermination at Rho-dependent terminators. EMBO J. (0261-4189) 2011 imex curation Rabhi M., Espéli O., Schwartz A., Cayrol B., Rahmouni AR., Arluison V., Boudvillain M. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Rabhi M., Espéli O., Schwartz A., Cayrol B., Rahmouni AR., Arluison V., Boudvillain M. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation The Sm-like RNA chaperone Hfq mediates transcription antitermination at Rho-dependent terminators. The Sm-like RNA chaperone Hfq mediates transcription antitermination at Rho-dependent terminators. EMBO J. (0261-4189) 2011 imex curation Rabhi M., Espéli O., Schwartz A., Cayrol B., Rahmouni AR., Arluison V., Boudvillain M. Only protein-protein interactions in vitro In vitro fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Rabhi M., Espéli O., Schwartz A., Cayrol B., Rahmouni AR., Arluison V., Boudvillain M. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation rho_ecoli Transcription termination factor Rho rho nitA psuA rnsC sbaA tsu b3783 ATP-dependent helicase Rho JW3756 protein protein ecoli Escherichia coli (strain K12) MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVNFDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDYNRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDDFFEMMKRS DIP protein P0AG30 original sequence version: 58 DIP protein P0AG30 original sequence version: 53 5970A85334C43467 rof_ecoli Protein rof yaeO rof b0189 JW0184 protein protein ecoli Escherichia coli (strain K12) MNDTYQPINCDDYDNLELACQHHLMLTLELKDGEKLQAKASDLVSRKNVEYLVVEAAGETRELRLDKITSFSHPEIGTVVVSES 1BD1E254B0F0A82E hfq_ecoli RNA-binding protein Hfq hfq b4172 Host factor-I protein HF-1 JW4130 protein protein ecoli Escherichia coli (strain K12) MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE DIP protein P0A6X3 original sequence version: 55 DIP protein P0A6X3 original sequence version: 60 E47FA9B07A39304D nusg_ecoli Transcription termination/antitermination protein NusG nusG b3982 JW3945 protein protein ecoli Escherichia coli (strain K12) MSEAPKKRWYVVQAFSGFEGRVATSLREHIKLHNMEDLFGEVMVPTEEVVEIRGGQRRKSERKFFPGYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRPAPISDKEVDAIMNRLQQVGDKPRPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKVSVSIFGRATPVELDFSQVEKA DIP protein P0AFG0 original sequence version: 38 This sequence has been withdrawn from Uniprot. B3AF94284CC17B04 hfq-rho 1 hfq 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 6.1 rho 3 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.6 direct interaction direct interaction mint f1b nusg-rho 1 nusG 6 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rho 3 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction f1c mint rof-rho 1 yaeO 4 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rho 3 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction sf1a mint hfq-rho-1 2 hfq 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rho 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction sf2 mint