MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Architecture of the flagellar rotor. Architecture of the flagellar rotor. EMBO J. (0261-4189) 2011 imex curation Paul K., Gonzalez-Bonet G., Bilwes AM., Crane BR., Blair D. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink weight by staining molecular weight estimation by staining weight by staining Paul K., Gonzalez-Bonet G., Bilwes AM., Crane BR., Blair D. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation Architecture of the flagellar rotor. Architecture of the flagellar rotor. EMBO J. (0261-4189) 2011 imex curation Paul K., Gonzalez-Bonet G., Bilwes AM., Crane BR., Blair D. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Paul K., Gonzalez-Bonet G., Bilwes AM., Crane BR., Blair D. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation Architecture of the flagellar rotor. Architecture of the flagellar rotor. EMBO J. (0261-4189) 2011 imex curation Paul K., Gonzalez-Bonet G., Bilwes AM., Crane BR., Blair D. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Paul K., Gonzalez-Bonet G., Bilwes AM., Crane BR., Blair D. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation flig_ecoli Flagellar motor switch protein FliG fliG fla AII.2 fla BII b1939 JW1923 protein protein ecoli Escherichia coli (strain K12) MSNLTGTDKSVILLMTIGEDRAAEVFKHLSQREVQTLSAAMANVTQISNKQLTDVLAEFEQEAEQFAALNINANDYLRSVLVKALGEERAASLLEDILETRDTASGIETLNFMEPQSAADLIRDEHPQIIATILVHLKRAQAADILALFDERLRHDVMLRIATFGGVQPAALAELTEVLNGLLDGQNLKRSKMGGVRTAAEIINLMKTQQEEAVITAVREFDGELAQKIIDEMFLFENLVDVDDRSIQRLLQEVDSESLLIALKGAEQPLREKFLRNMSQRAADILRDDLANRGPVRLSQVENEQKAILLIVRRLAETGEMVIGSGEDTYV DIP protein P0ABZ1 original sequence version: 85 E5CB4C0415C6E178 flim_thema Flagellar motor switch protein FliM fliM TM_0679 protein protein thema Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) MSDVLSQEEINQLIEALMKGELKEEDLLKEEEEKKVKPYDFKRPSKFSKEQLRTFQMIHENFGRALSTYLSGRLRTFVDVEISIDQLTYEEFIRSVMIPSFIVIFTGDVFEGSAIFEMRLDLFYTMLDIIMGGPGENPPNRPPTEIETSIMRKEVTNMLTLLAQAWSDFQYFIPSIENVETNPQFVQIVPPNEIVLLVTASVSWGEFTSFINVCWPFSLLEPLLEKLSDRFWMMGRKPEKVEERMEELRKASQKIPVTVQAVIGETELRLKEILDLEVGDVIRLGTHYKDEIRIDVEGRPKFRGIPGVFKGKYAVKVTGEFTNGGEYE DIP protein Q9WZE6 original sequence version: 86 mint 3E122C1FFAEBB093 flig_thema Flagellar motor switch protein FliG fliG TM_0220 protein protein thema Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) MPEKKIDGRRKAAVLLVALGPEKAAQVMKHLDEETVEQLVVEIANIGRVTPEEKKQVLEEFLSLAKAKEMISEGGIEYAKKVLEKAFGPERARKIIERLTSSLQVKPFSFVRDTDPVQLVNFLQSEHPQTIAVVLSYLDPPVAAQILGALPEELQTEVLKRIALLERTSPEVVKEIERNLEKKISGFVSRTFSKVGGIDTAAEIMNNLDRTTEKKIMDKLVQENPELADEIRRRMFVFEDILKLDDRSIQLVLREVDTRDLALALKGASDELKEKIFKNMSKRAAALLKDELEYMGPVRLKDVEEAQQKIINIIRRLEEAGEIVIARGGGEELIM mint 64C41D122622ABDA flim_ecoli Flagellar motor switch protein FliM fla AII fla QII b1945 fliM cheC2 JW1929 protein protein ecoli Escherichia coli (strain K12) MGDSILSQAEIDALLNGDSEVKDEPTASVSGESDIRPYDPNTQRRVVRERLQALEIINERFARHFRMGLFNLLRRSPDITVGAIRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEGREFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVRSEMQVKFTNITTSPNDIVVNTPFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRNEDQNWRDNLVRQVQHSQLELVANFADISLRLSQILKLNPGDVLPIEKPDRIIAHVDGVPVLTSQYGTLNGQYALRIEHLINPILNSLNEEQPK DIP protein P06974 original sequence version: null 05DC012B9364BFD6 flig-flim-2 2 FliM 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain fliG 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction mint f2a f2b f2d f2e st1 sf1b flig-flim-3 3 FliM 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fliG 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P0ABZ1:p.Leu225Trp mutation increasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L W Tue Jul 12 10:14:13 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 17:23:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu225trp' Tue Jun 30 19:03:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu225Trp' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association mint f3a sf2b flig-flim-4 3 FliM 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fliG 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P0ABZ1:p.Ile202Trp mutation increasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I W Tue Jul 12 10:53:41 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 18:42:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile202trp' Tue Jun 30 18:58:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile202Trp' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association mint f3a sf2b flig-flim-5 3 fliG 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain FliM 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell P06974:p.Phe131Asp mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F D Tue Jul 12 10:17:15 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:55:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe131asp' Tue Jun 30 19:56:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe131Asp' physical association physical association mint f3b sf2a flig-flim-6 3 fliG 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined FliM 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell P06974:p.Gly133Trp mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G W Tue Jul 12 10:17:27 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:26:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly133trp' Tue Jun 30 17:21:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly133Trp' physical association physical association mint f3b sf2a flig-flim-7 3 FliM 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell P06974:p.Arg156Asp mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R D Tue Jul 12 10:54:57 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:30:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg156asp' Tue Jun 30 19:17:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg156Asp' fliG 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association sf2a mint flig-flim-8 3 FliM 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell P06974:p.Thr149Asp mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T D Tue Jul 12 10:16:40 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:17:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr149asp' Tue Jun 30 17:44:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr149Asp' fliG 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association sf2a mint flig-flim-9 3 FliM 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell P06974:p.Val153Asp mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V D Tue Jul 12 10:56:41 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:15:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val153asp' Tue Jun 30 19:08:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val153Asp' fliG 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association sf2a mint flig-flim-10 3 FliM 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell P06974:p.Leu160Glu mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L E Tue Jul 12 10:19:56 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:12:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu160glu' Tue Jun 30 17:30:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu160Glu' fliG 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association sf2a mint flig-flim-11 1 fliG 4 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate P0ABZ1:p.Ile129Cys mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I C Tue Jul 12 10:56:32 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 18:54:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile129cys' Tue Jun 30 18:31:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile129Cys' FliM 7 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate P06974:p.Thr149Cys mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T C Tue Jul 12 10:19:26 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 18:02:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr149cys' Tue Jun 30 15:37:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr149Cys' physical association physical association f2c mint flig-flim-12 1 fliG 4 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate P0ABZ1:p.Met206Cys mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M C Tue Jul 12 10:56:30 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 19:15:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met206cys' Tue Jun 30 16:54:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met206Cys' FliM 7 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate P06974:p.Phe131Cys mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F C Tue Jul 12 10:19:36 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 20:33:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe131cys' Tue Jun 30 18:24:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe131Cys' physical association physical association mint f4a st3 flig-flim-13 1 FliM 7 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate P06974:p.Thr149Cys mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T C Tue Jul 12 10:56:34 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 19:53:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr149cys' Tue Jun 30 16:26:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr149Cys' fliG 4 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate P0ABZ1:p.Leu225Cys mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L C Tue Jul 12 10:56:21 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 18:47:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu225cys' Tue Jun 30 16:43:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu225Cys' physical association physical association mint f4a st3 flig-flim-14 1 fliG 4 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate P0ABZ1:p.Met206Cys mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M C Tue Jul 12 10:50:17 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 14:35:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met206cys' Tue Jun 30 16:21:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met206Cys' FliM 7 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate P06974:p.Val153Cys mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V C Tue Jul 12 10:50:15 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 16:15:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val153cys' Tue Jun 30 16:17:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val153Cys' physical association physical association mint f4a st3 flig-flig-3 1 fliG 4 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain undefined mutation mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 15:04:46 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation increasing' Val43Cys FliG 4 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain undefined mutation mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 15:04:39 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation increasing' Leu147Cys physical association physical association f5a mint The 43/147 Cys pair was crosslinked by BMH to form both dimer and trimer products. The corresponding single-Cys mutants either failed to crosslink (position 147) or formed dimer but none of the larger multimers (position 43) (Figure 5A). flig-1 1 fliG 4 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain undefined mutation mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:14:16 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation increasing' Val43Cys Stoichiometry: 2.0 physical association physical association f5a mint The 43/147 Cys pair was crosslinked by BMH to form both dimer and trimer products. The corresponding single-Cys mutants either failed to crosslink (position 147) or formed dimer but none of the larger multimers (position 43) (Figure 5A).