UniProt UniProt http://www.uniprot.org Idas, a novel phylogenetically conserved geminin-related protein, binds to geminin and is required for cell cycle progression. Idas, a novel phylogenetically conserved geminin-related protein, binds to geminin and is required for cell cycle progression. J. Biol. Chem. (0021-9258) 2011 mimix curation Pefani DE., Dimaki M., Spella M., Karantzelis N., Mitsiki E., Kyrousi C., Symeonidou IE., Perrakis A., Taraviras S., Lygerou Z. lygerou@med.upatras.gr 26-Jun-2011: Contacted by JYOTI. orchard human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pefani DE., Dimaki M., Spella M., Karantzelis N., Mitsiki E., Kyrousi C., Symeonidou IE., Perrakis A., Taraviras S., Lygerou Z. lygerou@med.upatras.gr Accepted 2011-JUN-09 by ORCHARD 26-Jun-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2011 orchard mimix curation Idas, a novel phylogenetically conserved geminin-related protein, binds to geminin and is required for cell cycle progression. Idas, a novel phylogenetically conserved geminin-related protein, binds to geminin and is required for cell cycle progression. J. Biol. Chem. (0021-9258) 2011 mimix curation Pefani DE., Dimaki M., Spella M., Karantzelis N., Mitsiki E., Kyrousi C., Symeonidou IE., Perrakis A., Taraviras S., Lygerou Z. lygerou@med.upatras.gr 26-Jun-2011: Contacted by JYOTI. orchard human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Pefani DE., Dimaki M., Spella M., Karantzelis N., Mitsiki E., Kyrousi C., Symeonidou IE., Perrakis A., Taraviras S., Lygerou Z. lygerou@med.upatras.gr Accepted 2011-JUN-09 by ORCHARD 26-Jun-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2011 orchard mimix curation Idas, a novel phylogenetically conserved geminin-related protein, binds to geminin and is required for cell cycle progression. Idas, a novel phylogenetically conserved geminin-related protein, binds to geminin and is required for cell cycle progression. J. Biol. Chem. (0021-9258) 2011 mimix curation Pefani DE., Dimaki M., Spella M., Karantzelis N., Mitsiki E., Kyrousi C., Symeonidou IE., Perrakis A., Taraviras S., Lygerou Z. lygerou@med.upatras.gr 26-Jun-2011: Contacted by JYOTI. orchard ecoli Escherichia coli (strain K12) pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Pefani DE., Dimaki M., Spella M., Karantzelis N., Mitsiki E., Kyrousi C., Symeonidou IE., Perrakis A., Taraviras S., Lygerou Z. lygerou@med.upatras.gr Accepted 2011-JUN-09 by ORCHARD 26-Jun-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2011 orchard mimix curation Idas, a novel phylogenetically conserved geminin-related protein, binds to geminin and is required for cell cycle progression. Idas, a novel phylogenetically conserved geminin-related protein, binds to geminin and is required for cell cycle progression. J. Biol. Chem. (0021-9258) 2011 mimix curation Pefani DE., Dimaki M., Spella M., Karantzelis N., Mitsiki E., Kyrousi C., Symeonidou IE., Perrakis A., Taraviras S., Lygerou Z. lygerou@med.upatras.gr 26-Jun-2011: Contacted by JYOTI. orchard human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pefani DE., Dimaki M., Spella M., Karantzelis N., Mitsiki E., Kyrousi C., Symeonidou IE., Perrakis A., Taraviras S., Lygerou Z. lygerou@med.upatras.gr Accepted 2011-JUN-09 by ORCHARD 26-Jun-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2011 orchard mimix curation Idas, a novel phylogenetically conserved geminin-related protein, binds to geminin and is required for cell cycle progression. Idas, a novel phylogenetically conserved geminin-related protein, binds to geminin and is required for cell cycle progression. J. Biol. Chem. (0021-9258) 2011 mimix curation Pefani DE., Dimaki M., Spella M., Karantzelis N., Mitsiki E., Kyrousi C., Symeonidou IE., Perrakis A., Taraviras S., Lygerou Z. lygerou@med.upatras.gr 26-Jun-2011: Contacted by JYOTI. orchard human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Pefani DE., Dimaki M., Spella M., Karantzelis N., Mitsiki E., Kyrousi C., Symeonidou IE., Perrakis A., Taraviras S., Lygerou Z. lygerou@med.upatras.gr Accepted 2011-JUN-09 by ORCHARD 26-Jun-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2011 orchard mimix curation Idas, a novel phylogenetically conserved geminin-related protein, binds to geminin and is required for cell cycle progression. Idas, a novel phylogenetically conserved geminin-related protein, binds to geminin and is required for cell cycle progression. J. Biol. Chem. (0021-9258) 2011 mimix curation Pefani DE., Dimaki M., Spella M., Karantzelis N., Mitsiki E., Kyrousi C., Symeonidou IE., Perrakis A., Taraviras S., Lygerou Z. lygerou@med.upatras.gr 26-Jun-2011: Contacted by JYOTI. orchard ecoli Escherichia coli (strain K12) light scattering light scattering predetermined predetermined participant predetermined Pefani DE., Dimaki M., Spella M., Karantzelis N., Mitsiki E., Kyrousi C., Symeonidou IE., Perrakis A., Taraviras S., Lygerou Z. lygerou@med.upatras.gr Accepted 2011-JUN-09 by ORCHARD 26-Jun-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2011 orchard mimix curation Idas, a novel phylogenetically conserved geminin-related protein, binds to geminin and is required for cell cycle progression. Idas, a novel phylogenetically conserved geminin-related protein, binds to geminin and is required for cell cycle progression. J. Biol. Chem. (0021-9258) 2011 mimix curation Pefani DE., Dimaki M., Spella M., Karantzelis N., Mitsiki E., Kyrousi C., Symeonidou IE., Perrakis A., Taraviras S., Lygerou Z. lygerou@med.upatras.gr 26-Jun-2011: Contacted by JYOTI. orchard in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Pefani DE., Dimaki M., Spella M., Karantzelis N., Mitsiki E., Kyrousi C., Symeonidou IE., Perrakis A., Taraviras S., Lygerou Z. lygerou@med.upatras.gr Accepted 2011-JUN-09 by ORCHARD 26-Jun-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2011 orchard mimix curation gemi_human Geminin GMNN protein protein human Homo sapiens Human MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI DIP protein O75496 original sequence version: 78 DIP protein O75496 original sequence version: 117 DIP protein O75496 original sequence version: 136 0BABE60F6F5AC252 mcin_human Multicilin MCIDAS IDAS MCI MCIN Multiciliate differentiation and DNA synthesis-associated cell cycle protein Protein Idas protein protein human Homo sapiens Human MQACGGGAAGRRAFDSICPNRMLALPGRALLCKPGKPERKFAPPRKFFPGCTGGSPVSVYEDPPDAEPTALPALTTIDLQDLADCSSLLGSDAPPGGDLAASQNHSHQTEADFNLQDFRDTVDDLISDSSSMMSPTLASGDFPFSPCDISPFGPCLSPPLDPRALQSPPLRPPDVPPPEQYWKEVADQNQRALGDALVENNQLHVTLTQKQEEIASLKERNVQLKELASRTRHLASVLDKLMITQSRDCGAAAEPFLLKAKAKRSLEELVSAAGQDCAEVDAILREISERCDEALQSRDPKRPRLLPEPANTDTRPGNLHGAFRGLRTDCSRSALNLSHSELEEGGSFSTRIRSHSTIRTLAFPQGNAFTIRTANGGYKFRWVPS cdt1_human DNA replication factor Cdt1 Double parked homolog CDT1 protein protein human Homo sapiens Human MEQRRVTDFFARRRPGPPRIAPPKLACRTPSPARPALRAPASATSGSRKRARPPAAPGRDQARPPARRRLRLSVDEVSSPSTPEAPDIPACPSPGQKIKKSTPAAGQPPHLTSAQDQDTISELASCLQRARELGARVRALKASAQDAGESCTPEAEGRPEEPCGEKAPAYQRFHALAQPGLPGLVLPYKYQVLAEMFRSMDTIVGMLHNRSETPTFAKVQRGVQDMMRRRFEECNVGQIKTVYPASYRFRQERSVPTFKDGTRRSDYQLTIEPLLEQEADGAAPQLTASRLLQRRQIFSQKLVEHVKEHHKAFLASLSPAMVVPEDQLTRWHPRFNVDEVPDIEPAALPQPPATEKLTTAQEVLARARNLISPRMEKALSQLALRSAAPSSPGSPRPALPATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQRLERLPELARVLRSVFVSERKPALSMEVACARMVGSCCTIMSPGEMEKHLLLLSELLPDWLSLHRIRTDTYVKLDKAADLAHITARLAHQTRAEEGL DIP protein Q9H211 original sequence version: 69 DIP protein Q9H211 original sequence version: 124 8179D0330C135FB7 d6rgh6-gmnn 1 9 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association gmnn-d6rgh6 4 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Fig. 2B gmnn-d6rgh6-1 1 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association d6rgh6-gmnn-1 4 9 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association Supp. Fig. 2B d6rgh6-d6rgh6-1 1 9 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role prey prey gfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association d6rgh6-gmnn-2 2 9 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association IDAS prevents GMNN interaction with CDT1 Fig. 2E gmnn-cdt1-1 2 8 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Fig. 2E d6rgh6-3 6 9 unspecified role unspecified role neutral component neutral component direct interaction direct interaction Fig. 3C d6rgh6-gmnn-3 3 9 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association Fig. 3A cdt1-gmnn-9 7 10 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey direct interaction direct interaction d6rgh6-gmnn-5 5 9 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 4 IDAS targets GMNN to the nucleus.