MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Co-translational function of Cosmc, core 1 synthase specific molecular chaperone, revealed by a cell-free translation system. Co-translational function of Cosmc, core 1 synthase specific molecular chaperone, revealed by a cell-free translation system. FEBS Lett. (0014-5793) 2011 imex curation Narimatsu Y., Kubota T., Furukawa S., Shimojima M., Iwasaki H., Tozawa Y., Tachibana K., Narimatsu H. suggested by lperfetto h.narimatsu@aist.go.jp Only protein-protein interactions in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Narimatsu Y., Kubota T., Furukawa S., Shimojima M., Iwasaki H., Tozawa Y., Tachibana K., Narimatsu H. suggested by lperfetto h.narimatsu@aist.go.jp FEBS Lett. (0014-5793) 2011 Only protein-protein interactions imex curation c1glt_human Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 C1GALT1 Core 1 beta1,3-galactosyltransferase 1 Core 1 UDP-galactose:N-acetylgalactosamine-alpha-R beta 1,3-galactosyltransferase 1 Core 1 O-glycan T-synthase B3Gal-T8 protein protein human Homo sapiens Human MASKSWLNFLTFLCGSAIGFLLCSQLFSILLGEKVDTQPNVLHNDPHARHSDDNGQNHLEGQMNFNADSSQHKDENTDIAENLYQKVRILCWVMTGPQNLEKKAKHVKATWAQRCNKVLFMSSEENKDFPAVGLKTKEGRDQLYWKTIKAFQYVHEHYLEDADWFLKADDDTYVILDNLRWLLSKYDPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVDAFKTDKCTHSSSIEDLALGRCMEIMNVEAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQANKNEDTKVKLGNP mint Glycosyltransferase that generates the core 1 O-glycan Gal-beta1-3GalNAc-alpha1-Ser/Thr (T antigen), which is a precursor for many extended O-glycans in glycoproteins. Plays a central role in many processes, such as angiogenesis, thrombopoiesis and kidney homeostasis development Defects in C1GALT1 may be a cause of susceptibility to IgA nephropathy (IgAN). IgAN is the most common primary glomerulonephritis, which is partly due to aberrant or incomplete galactosylation of IgA1 molecules 01F472B55C5F526F c1glc_human C1GALT1-specific chaperone 1 C1GALT1C1 COSMC C38H2-like protein 1 Core 1 beta1,3-galactosyltransferase 2 Core 1 beta3-galactosyltransferase-specific molecular chaperone HSPC067 MSTP143 UNQ273/PRO310 protein protein human Homo sapiens Human MLSESSSFLKGVMLGSIFCALITMLGHIRIGHGNRMHHHEHHHLQAPNKEDILKISEDERMELSKSFRVYCIILVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDTNDMWLMMRKAYKYAFDKYRDQYNWFFLARPTTFAIIENLKYFLLKKDPSQPFYLGHTIKSGDLEYVGMEGGIVLSVESMKRLNSLLNIPEKCPEQGGMIWKISEDKQLAVCLKYAGVFAENAEDADGKDVFNTKSVGLSIKEAMTYHPNQVVEGCCSDMAVTFNGLTPNQMHVMMYGVYRLRAFGHIFNDALVFLPPNGSDND 5D766966A872CA84 c1galt1-c1galt1c1 1 C1GalT 2 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component in vitro translated in vitro translated protein in vitro translated flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Cosmc 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined stimulator stimulator neutral component neutral component in vitro translated in vitro translated protein in vitro translated his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f1 homomint mint c1galt1-c1galt1c1-1 1 C1GalT 2 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component in vitro translated in vitro translated protein in vitro translated his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Cosmc 3 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined stimulator stimulator neutral component neutral component in vitro translated in vitro translated protein in vitro translated his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f1 homomint mint c1galt1-c1galt1c1-2 1 C1GalT 2 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component in vitro translated in vitro translated protein in vitro translated flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Cosmc 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined stimulator stimulator neutral component neutral component purified purified direct interaction direct interaction f2 homomint mint c1galt1-c1galt1c1-3 1 C1GalT 2 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component in vitro translated in vitro translated protein in vitro translated his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Cosmc 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined stimulator stimulator neutral component neutral component purified purified direct interaction direct interaction f2 homomint mint