MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Sld7, an Sld3-associated protein required for efficient chromosomal DNA replication in budding yeast. Sld7, an Sld3-associated protein required for efficient chromosomal DNA replication in budding yeast. EMBO J. (0261-4189) 2011 imex curation Tanaka T., Umemori T., Endo S., Muramatsu S., Kanemaki M., Kamimura Y., Obuse C., Araki H. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tanaka T., Umemori T., Endo S., Muramatsu S., Kanemaki M., Kamimura Y., Obuse C., Araki H. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation Sld7, an Sld3-associated protein required for efficient chromosomal DNA replication in budding yeast. Sld7, an Sld3-associated protein required for efficient chromosomal DNA replication in budding yeast. EMBO J. (0261-4189) 2011 imex curation Tanaka T., Umemori T., Endo S., Muramatsu S., Kanemaki M., Kamimura Y., Obuse C., Araki H. Only protein-protein interactions in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Tanaka T., Umemori T., Endo S., Muramatsu S., Kanemaki M., Kamimura Y., Obuse C., Araki H. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation Sld7, an Sld3-associated protein required for efficient chromosomal DNA replication in budding yeast. Sld7, an Sld3-associated protein required for efficient chromosomal DNA replication in budding yeast. EMBO J. (0261-4189) 2011 imex curation Tanaka T., Umemori T., Endo S., Muramatsu S., Kanemaki M., Kamimura Y., Obuse C., Araki H. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Tanaka T., Umemori T., Endo S., Muramatsu S., Kanemaki M., Kamimura Y., Obuse C., Araki H. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation Sld7, an Sld3-associated protein required for efficient chromosomal DNA replication in budding yeast. Sld7, an Sld3-associated protein required for efficient chromosomal DNA replication in budding yeast. EMBO J. (0261-4189) 2011 imex curation Tanaka T., Umemori T., Endo S., Muramatsu S., Kanemaki M., Kamimura Y., Obuse C., Araki H. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Tanaka T., Umemori T., Endo S., Muramatsu S., Kanemaki M., Kamimura Y., Obuse C., Araki H. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation Sld7, an Sld3-associated protein required for efficient chromosomal DNA replication in budding yeast. Sld7, an Sld3-associated protein required for efficient chromosomal DNA replication in budding yeast. EMBO J. (0261-4189) 2011 imex curation Tanaka T., Umemori T., Endo S., Muramatsu S., Kanemaki M., Kamimura Y., Obuse C., Araki H. Only protein-protein interactions ecoli Escherichia coli (strain K12) pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Tanaka T., Umemori T., Endo S., Muramatsu S., Kanemaki M., Kamimura Y., Obuse C., Araki H. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation Sld7, an Sld3-associated protein required for efficient chromosomal DNA replication in budding yeast. Sld7, an Sld3-associated protein required for efficient chromosomal DNA replication in budding yeast. EMBO J. (0261-4189) 2011 imex curation Tanaka T., Umemori T., Endo S., Muramatsu S., Kanemaki M., Kamimura Y., Obuse C., Araki H. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast pull down pull down predetermined predetermined participant predetermined Tanaka T., Umemori T., Endo S., Muramatsu S., Kanemaki M., Kamimura Y., Obuse C., Araki H. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation sld7_yeast Mitochondrial morphogenesis protein SLD7 YOR29-11 YOR060C SLD7 Synthetic lethality with DPB11-24 mutation protein 7 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSRKLCTLNFTLSGKQGSLVIRDIQLWSNRPTASKSTSELRGQFIQYVDLAKLPLWVRSTNMNTYRCYSTSATAQAYFKSKLRNANRGIVIELFDKVDQRSQEPAYLIIFRENTELNCFQVDLTMKHEFDGQVTKLKQDIGKTRASVSKEGSIDIIIQQSQQRKIGTKTEVYRNVHINDKRLQFNETLSKLILGGLRLRGISNSITDYQKLYKITFDAAEFTHRDELKRISMGSGEEVSFESLQETVETLLKLFTKS 8D79B4B1B8CD9C01 cdc45_yeast Cell division control protein 45 CDC45 YLR103C L8004.11 SLD4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MYYGISQFSEAYNKILRNSSSHSSCQLVIFVSCLNIDALCATKMLSLLFKKQLVQSQIVPIFGYSELRRHYSQLDDNINSLLLVGFGGVIDLEAFLEIDPQEYVIDTDEKSGEQSFRRDIYVLDAHRPWNLDNIFGSQIIQCFDDGTVDDTLGEQKEAYYKLLELDEESGDDELSGDENDNNGGDDEATDADEVTDEDEEDEDETISNKRGNSSIGPNDLSKRKQRKKQIHEYEGVLEEYYSQGTTVVNSISAQIYSLLSAIGETNLSNLWLNILGTTSLDIAYAQVYNRLYPLLQDEVKRLTPSSRNSVKTPDTLTLNIQPDYYLFLLRHSSLYDSFYYSNYVNAKLSLWNENGKKRLHKMFARMGIPLSTAQETWLYMDHSIKRELGIIFDKNLDRYGLQDIIRDGFVRTLGYRGSISASEFVEALTALLEVGNSTDKDSVKINNDNNDDTDGEEEEDNSAQKLTNLRKRWVSNFWLSWDALDDRKVELLNRGIQLAQDLQRAIFNTGVAILEKKLIKHLRIYRLCVLQDGPDLDLYRNPLTLLRLGNWLIECCAESEDKQLLPMVLASIDENTDTYLVAGLTPRYPRGLDTIHTKKPILNNFSMAFQQITAETDAKVRIDNFESSIIEIRREDLSPFLEKLTLSGLL 6500DDD62EC4E8EE 6500DDD62EC4E8EE sld3_yeast DNA replication regulator SLD3 SLD3 G2980 YGL113W protein protein yeast Saccharomyces cerevisiae Baker's yeast METWEVIASVKEATKGLDLSLDHPLIIKSEDVPSNILQLLQQKNRRQLKHICMKSRKEYFLLEEYGPGFWVKWPYNYFNGYSLPERRTEVVTTVERERAKRETLKTWDELKFKELLHLWSEEPKGSCKLEKDKDLKLDMNPPDMKGESKINDYYSDPKEYIESKYYDALFSIHTPLAYFVKSNLVRLKNTCRTKYGSDSYKIAYQAMLQKFLLSIVQFKDRHDNRLLLEPFSSPIADEKRKNCLTKFVIQDENKNSSTIADLCVVLKSREIKLQILLLLEIIGLNDLDWNFRDFEKKYKLKLKKRSLNLTKKGLVRRRSKKKTSEKDKGIERITTSLDYCEQLDLYLDRACILDILLSSETPNPDAIEASNGTIQEHKKNILDKSKEASLVGFINYVLIPYFNKKVPHAVEFIIQKLKGPSMRPKRALKKVNDSTNVSSPNTVETYNRLSTSQRASRSSIINSVPSSPALRRVDANLFSRKSIASPTPELLNSRTNSNLNEFLESETRSLKRPSQLGRTKSDLTMNHLQKRQFSVSDLSTTRVPNSSTITLKTPFSHSTINAYKTMNNSFRRVGKRKDINETIRLHERVDSEENVQVQATPAVKKRTVTPNKKAQLQSIIESPLNFKDDDTHEGRKNTSNITSTPTNKPPENSSKRRVRRRLFAPEST 6E59D0DB3C082C28 6E59D0DB3C082C28 sld3-sld7 4 SLD7 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified SLD3 9 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f2c mint sld3-cdc45-2 4 SLD3 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cdc45 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction f7a mint cdc45-sld3-2 4 cdc45 8 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SLD3 9 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction mint sf6a cdc45-sld3-3 4 cdc45 8 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SLD7 7 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified SLD3 9 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified physical association physical association mint sf6a sld3-cdc45-3 4 SLD7 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified SLD3 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cdc45 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified physical association physical association f7a mint sld7-sld3 1 SLD7 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SLD3 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association f3a mint sld7-sld3-1 1 SLD7 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SLD3 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f3a mint cdc45-sld3-4 1 SLD3 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cdc45 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3a mint sld3-sld7-1 2 SLD7 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component partially purified partially purified SLD3 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component partially purified partially purified physical association physical association f2d mint sld7-sld3-2 6 SLD3 9 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level SLD7 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tandem tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2a mint sld7-sld3-3 6 SLD3 9 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SLD7 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint f2e sf3a sld3-sld7-2 5 SLD7 7 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell SLD3 9 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2b mint sld3-sld7-3 3 SLD3 9 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SLD7 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint f2f sf3b