IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Membrane-SPINE: an improved method to identify protein-protein interaction partners of membrane proteins in vivo. Membrane-SPINE: an improved method to identify protein-protein interaction partners of membrane proteins in vivo. Proteomics (1615-9853) 2011 imex curation Muller V.S., Jungblut P.R., Meyer T.F., Hunke S. Membrane-SPINE combines the highly specific purification of a Strep-tagged protein with the fixation of protein complexes in a cell by formaldehyde cross-linking. (sabine.hunke@hu-berlin.de 23-Sept-2011: Contacted by JYOTI. orchard Only protein-protein interactions salts Salmonella typhimurium (strain SL1344) pull down pull down sequence tag sequence tag identification sequence tag Muller V.S., Jungblut P.R., Meyer T.F., Hunke S. Membrane-SPINE combines the highly specific purification of a Strep-tagged protein with the fixation of protein complexes in a cell by formaldehyde cross-linking. Interactions have been entered for the Strain SL1344, as this is the strain stated to have been used. However in Table S1, the GI accession numbers given refer to Strains CT18 and in one instance, Strain LT2. For two proteins ( UniProt E1WG52/GI16760705 and E1W9N2/GI16759678) the percentage identity between strains (SL 1344 and strain referred to by GI number) is 99%, rather than 100%. (sabine.hunke@hu-berlin.de Accepted 2011-AUG-09 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Proteomics (1615-9853) 2011 orchard Only protein-protein interactions imex curation Membrane-SPINE: an improved method to identify protein-protein interaction partners of membrane proteins in vivo. Membrane-SPINE: an improved method to identify protein-protein interaction partners of membrane proteins in vivo. Proteomics (1615-9853) 2011 imex curation Muller V.S., Jungblut P.R., Meyer T.F., Hunke S. Membrane-SPINE combines the highly specific purification of a Strep-tagged protein with the fixation of protein complexes in a cell by formaldehyde cross-linking. (sabine.hunke@hu-berlin.de 23-Sept-2011: Contacted by JYOTI. orchard Only protein-protein interactions salts Salmonella typhimurium (strain SL1344) pull down pull down western blot western blot Immuno blot Immuno blot Muller V.S., Jungblut P.R., Meyer T.F., Hunke S. Membrane-SPINE combines the highly specific purification of a Strep-tagged protein with the fixation of protein complexes in a cell by formaldehyde cross-linking. (sabine.hunke@hu-berlin.de Accepted 2011-AUG-09 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Proteomics (1615-9853) 2011 orchard Only protein-protein interactions imex curation a0a0h3ncz1_salts 30S ribosomal protein S2 rpsB G1W50_14355 G1W53_15330 G1W54_15710 G1W55_14830 G1W56_16215 G1W57_14245 G1W59_06145 G1W62_14895 G1W63_16020 G1W64_16035 G1W66_14610 G1W67_14890 G1W69_14600 G1W71_14670 G1W72_09135 G1W73_04950 G1X27_17785 G1X29_16065 G1X31_09440 G1X32_15415 G1X35_15860 G1X38_15720 G1X41_21070 G1X42_03035 G1X44_14645 G1X46_09480 G1X47_14725 G1X49_15915 G1X50_13565 G1X51_16360 G1X52_16040 G1X80_15390 G1X54_16820 G1X84_14785 G1X57_12525 G1X61_14900 G1X64_14645 G1X85_15285 G1X66_15720 G1X86_14815 G1X87_14925 G1X67_14645 G1X94_13680 G1X96_14825 G1X68_14800 G1X98_11425 G1X99_16045 G1X69_16630 G1X71_16365 G1X75_14860 G1X76_15390 G1X77_14835 G1Y02_15420 G1Y04_14640 G1Y11_14165 SL1344_0217 G1W74_14250 G1W84_11430 G1W85_11425 G1W86_14620 G1W87_14750 G1W89_15510 G1W92_03035 G1W99_05240 G1X00_10695 G1X03_15900 G1X04_13705 G1X06_14610 G1X09_16360 G1X10_16275 G1X11_09485 G1X12_08370 G1X13_16355 G1X15_18365 G1X17_16365 G1X18_10700 G1X19_13950 G1X23_15750 protein protein salts Salmonella typhimurium (strain SL1344) MATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFNEALAELNKISARKGKILFVGTKRAASEAVKEAANSCDQFFVNHRWLGGMLTNWKTVRQSIKRLKDLETQSQDGTFEKLTKKEALMRTRELEKLENSLGGIKDMGGLPDALFVIDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVSLYLGAVAATVREGRSQDLASQAEESFVEAE 81FF93FD1559A376 a0a0h3nec8_salts Succinate--CoA ligase [ADP-forming] subunit alpha sucD G1X76_03315 G1X80_03315 G1X84_00155 G1X85_03315 G1X86_00155 G1X87_00155 G1X94_00155 G1X96_00155 G1X99_03250 G1Y02_00155 G1Y04_00155 G1Y11_00155 SL1344_0721 Succinyl-CoA synthetase subunit alpha G1W50_00155 G1W53_03315 G1W54_03315 G1W56_06670 G1W62_00155 G1W63_03315 G1W64_03250 G1X32_00155 G1W67_00155 G1X38_03315 G1W86_14935 G1X41_07580 G1W87_03250 G1W89_06100 G1W92_08045 G1X03_03205 G1X42_08045 G1X04_20005 G1X44_00155 G1X09_06410 G1X47_00155 G1X10_06330 G1X49_03315 G1X13_06410 G1X17_06410 G1X50_00155 G1X23_06315 G1X51_06410 G1X52_03255 G1X29_06410 G1X57_00155 G1X61_00155 G1X64_00155 G1X66_03315 G1X67_00155 G1X68_05665 G1X69_06675 G1X71_06415 protein protein salts Salmonella typhimurium (strain SL1344) MSVLINKDTKVICQGFTGSQGTFHSEQAIAYGTQMVGGVTPGKGGTTHLGLPVFNTVREAVEATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNCPGVITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGGDPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAYIKDHVTKPVVGYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKAIIK 00BFD9E0D6E359DB a0a0h3nuz2_salts Histidine kinase cpxA G1W56_17620 G1W59_15150 G1W62_18230 G1W57_18530 G1W63_17420 G1X50_17975 G1X51_17765 G1X52_17455 G1X54_18675 G1X57_16685 G1X61_18230 G1X64_17985 G1X66_17130 G1X67_17975 G1X68_18585 G1X69_18035 G1X71_17770 G1X75_19145 G1X76_16795 G1X77_19120 G1X80_16795 G1X84_16190 G1X85_17580 G1X86_17125 G1X87_18260 G1X94_16095 G1X96_17130 G1X98_17030 G1X99_17455 G1Y02_16825 G1Y04_17970 G1Y11_16560 SL1344_4007 G1W64_17450 G1W66_17980 G1W67_17330 G1W69_17955 G1W71_18955 G1W72_14955 G1W73_14660 G1W74_18535 G1W84_16240 G1W85_17035 G1W86_16210 G1W87_17070 G1W89_16915 G1W92_20090 G1W99_20975 G1X00_11865 G1X03_17310 G1X04_09250 G1X06_18290 G1X09_17765 G1X10_17675 G1X11_10655 G1X12_09540 G1X13_17755 G1X17_17780 G1X18_11870 G1X19_17480 G1X23_17150 G1X27_20335 G1X29_17465 G1X31_10610 G1X32_17715 G1X35_17395 G1X38_18010 G1X41_20105 G1X42_20095 G1X44_17040 G1X46_10650 G1X47_16130 G1X49_17315 G1W50_16645 G1W53_16525 G1W54_17115 G1W55_19110 protein protein salts Salmonella typhimurium (strain SL1344) MIGSLTARIFAIFWLTLALVLMLVLMLPKLDSRQMTELLDSEQRQGLMIEQHVEAELANDPPNDLMWWRRLFRAIDKWAPPGQRLLLVTSEGRVIGAERSEMQIIRNFIGQADNADHPQKKKYGRVEMVGPFSVRDGEDNYQLYLIRPASSSQSDFINLLFDRPLLLLIVTMLVSSPLLLWLAWSLAKPARKLKNAADEVAQGNLRQHPELEAGPQEFLAAGASFNQMVTALERMMTSQQRLLSDISHELRTPLTRLQLGTALLRRRGGESKELERIETEAQRLDSMINDLLVMSRNQQKNALVSETMKANQLWGEVLDNAAFEAEQMGKSLTVNYPPGPWPLYGNPNALESALENIVRNALRYSHTKIEVGFSVDKDGITITVDDDGPGVSPEDREQIFRPFYRTDEARDRESGGTGLGLAIVESAMQQHRGWVKADDSPLGGLRLTLWLPLYKRT 5F7C8EEA944488FC a0a0h3nk16_salts cpxR G1W50_16650 G1W53_16530 G1W54_17120 G1W55_19115 G1W56_17625 G1W57_18535 G1W62_18235 G1W63_17425 G1W64_17455 G1W66_17985 G1W67_17335 G1W69_17960 G1W71_18960 G1W74_18540 G1W86_16215 G1W87_17075 G1W89_16920 G1W92_20095 G1W99_20980 G1X03_17315 G1X04_09255 G1X06_18295 G1X09_17770 G1X10_17680 G1X13_17760 G1X15_21265 G1X17_17785 G1X19_17475 G1X23_17155 G1X27_20340 G1X29_17470 G1X32_17720 G1X35_17400 G1X38_18015 G1X41_20100 G1X42_20100 G1X44_17045 G1X47_16135 G1X49_17320 G1X50_17980 G1X51_17770 G1X52_17460 G1X54_18680 G1X57_16690 G1X61_18235 G1X64_17990 G1X66_17135 G1X67_17980 G1X68_18590 G1X69_18040 G1X71_17775 G1X75_19150 G1X76_16800 G1X77_19125 SL1344_4008 G1X80_16800 G1X84_16195 G1X85_17585 G1X86_17130 G1X87_18265 G1X94_16100 G1X96_17135 G1X99_17460 G1Y02_16830 G1Y04_17975 G1Y11_16565 protein protein salts Salmonella typhimurium (strain SL1344) MNKILLVDDDRELTSLLKELLEMEGFNVLVAHDGEQALELLDDSIDLLLLDVMMPKKNGIDTLKALRQTHQTPVIMLTARGSELDRVLGLELGADDYLPKPFNDRELVARIRAILRRSHWSEQQQSSDNGSPTLEVDALSLNPGRQEASFDGQTLELTGTEFTLLYLLAQHLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPERKDGHPWFKTLRGRGYLMVSAS 187C3AF5CC59B44A a0a0h3nc49_salts Cell division inhibitor MinD minD G1Y04_23120 G1Y11_22655 SL1344_1743 G1W50_17035 G1W53_00015 G1W54_00015 G1W55_02960 G1W56_03370 G1W57_02600 G1W62_23380 G1W63_00015 G1W64_22345 G1W74_02600 G1W66_02960 G1W67_23375 G1W69_02960 G1W71_02960 G1W86_21640 G1W87_21590 G1W89_21170 G1W92_16330 G1W99_12265 G1X03_00015 G1X04_12070 G1X06_19605 G1X09_03110 G1X10_00015 G1X13_03110 G1X15_00320 G1X17_03110 G1X19_00930 G1X23_00015 G1X27_21650 G1X29_03110 G1X32_22565 G1X35_18755 G1X38_00015 G1X41_04180 G1X42_16335 G1X44_22190 G1X47_22290 G1X49_00015 G1X50_23125 G1X51_03110 G1X52_22300 G1X54_02960 G1X57_23095 G1X61_23950 G1X64_23135 G1X66_00015 G1X67_23115 G1X68_00015 G1X69_03375 G1X71_03115 G1X75_02960 G1X76_00015 G1X77_02960 G1X80_00015 G1X84_22310 G1X85_00015 G1X86_05460 G1X87_23415 G1X94_22105 G1X96_05465 G1X99_22825 G1Y02_22305 Septum site-determining protein MinD protein protein salts Salmonella typhimurium (strain SL1344) MARIIVVTSGKGGVGKTTSSAAIATGLAQKGKKTVVIDFDIGLRNLDLIMGCERRVVYDFVNVIQGDATLNQALIKDKRTENLFILPASQTRDKDALTREGVAKVLDSLKAMDFEFIVCDSPAGIETGALMALYFADEAIITTNPEVSSVRDSDRILGILASKSRRAENGEEPIKEHLLLTRYNPGRVNKGDMLSMEDVLEILRIKLVGVIPEDQSVLRASNQGEPVILDATADAGKAYADTVDRLLGEERPFRFIEEEKKGFLKRLFGG 15D677E790760031 a0a0h3nhr4_salts ATP synthase gamma chain G1X38_22420 G1X41_21970 G1X42_21175 G1X44_21750 G1X47_21850 G1W50_21715 G1W53_21565 G1W54_22160 G1W55_23155 G1W56_21530 G1W57_22565 G1W62_22940 G1W63_20810 G1W64_21480 G1W66_22725 G1W67_22940 G1W69_22695 G1W71_23000 G1W74_22570 G1W86_20580 G1W87_21460 G1W89_20730 G1W92_21170 G1W99_18135 G1X03_21775 G1X04_15320 G1X06_22075 G1X09_22740 G1X10_22095 G1X13_22165 G1X15_23055 G1X17_22970 G1X19_21875 G1X23_22070 G1X27_22700 G1X29_21875 G1X49_22350 G1X50_22685 G1X51_21155 G1X52_21860 G1X54_23250 G1X57_21920 G1X61_23510 G1X64_22695 G1X66_21945 G1X67_22680 G1X68_22960 G1X69_22440 G1X71_22175 G1X75_23190 G1X76_21825 G1X77_23165 G1X80_21960 G1X84_21870 G1X85_21395 G1X86_22165 G1X87_22975 atpG G1X35_21545 G1X94_21260 SL1344_3833 ATP synthase F1 sector gamma subunit F-ATPase gamma subunit G1X96_22170 G1X99_22385 G1Y02_21865 G1Y04_22680 G1X32_22125 G1Y11_21855 protein protein salts Salmonella typhimurium (strain SL1344) MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLANGNLEYKHPYLEERDVKRVGYLVVSTDRGLCGGLNINLFKKLLADMKAWSDKGVQCELAMIGSKGVSFFNSVGGNVVAQVTGMGDNPSLSELIGPVKVMLQAYDEGRLDKLYIVSNKFINTMSQVPTITQLLPLPASEDDDLKRKAWDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASITQELTEIVSGAAAV C33B55F0F5E4FA29 cpxa-cpxr-2 2 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait c_terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig 2A The signal from the endogenous CpxR protein was weaker than the signal for the overexpressed CpxR. cpxa-atpg-4 1 3 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait c_terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 6 unspecified role unspecified role prey prey association association Fig 2B, Table S1. Endogenous CpxR was verified, among other potential interaction partners, as an example of an unknown (i.e. not previously predicted) interaction partner of the bait protein CpxA.