IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A Genome-wide multidimensional RNAi screen reveals pathways controlling MHC class II antigen presentation. A Genome-wide multidimensional RNAi screen reveals pathways controlling MHC class II antigen presentation. Cell (0092-8674) 2011 imex curation Paul P., van den Hoorn T., Jongsma ML., Bakker MJ., Hengeveld R., Janssen L., Cresswell P., Egan DA., van Ham M., Ten Brinke A., Ovaa H., Beijersbergen RL., Kuijl C., Neefjes J. GTP loading tracked using 32P-ATP. kuijl.coenraad@gene.com, j.neefjes@nki.nl 26-Sep-2011: Contacted by JYOTI. jyoti Only protein-protein interactions human-pbmc Human Peripheral Blood Mononuclear cell peripheral_blood_mononuclear_cell Peripheral blood mononuclear cell anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Paul P., van den Hoorn T., Jongsma ML., Bakker MJ., Hengeveld R., Janssen L., Cresswell P., Egan DA., van Ham M., Ten Brinke A., Ovaa H., Beijersbergen RL., Kuijl C., Neefjes J. GTP loading tracked using 32P-ATP. kuijl.coenraad@gene.com, j.neefjes@nki.nl Accepted 2011-JUL-06 by JYOTI 26-Sep-2011: Contacted by JYOTI. Cell (0092-8674) 2011 jyoti Only protein-protein interactions imex curation A Genome-wide multidimensional RNAi screen reveals pathways controlling MHC class II antigen presentation. A Genome-wide multidimensional RNAi screen reveals pathways controlling MHC class II antigen presentation. Cell (0092-8674) 2011 imex curation Paul P., van den Hoorn T., Jongsma ML., Bakker MJ., Hengeveld R., Janssen L., Cresswell P., Egan DA., van Ham M., Ten Brinke A., Ovaa H., Beijersbergen RL., Kuijl C., Neefjes J. GTP loading tracked using 32P-ATP. kuijl.coenraad@gene.com, j.neefjes@nki.nl 26-Sep-2011: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay western blot western blot Immuno blot Immuno blot Paul P., van den Hoorn T., Jongsma ML., Bakker MJ., Hengeveld R., Janssen L., Cresswell P., Egan DA., van Ham M., Ten Brinke A., Ovaa H., Beijersbergen RL., Kuijl C., Neefjes J. GTP loading tracked using 32P-ATP. kuijl.coenraad@gene.com, j.neefjes@nki.nl Accepted 2011-JUL-06 by JYOTI 26-Sep-2011: Contacted by JYOTI. Cell (0092-8674) 2011 jyoti Only protein-protein interactions imex curation A Genome-wide multidimensional RNAi screen reveals pathways controlling MHC class II antigen presentation. A Genome-wide multidimensional RNAi screen reveals pathways controlling MHC class II antigen presentation. Cell (0092-8674) 2011 imex curation Paul P., van den Hoorn T., Jongsma ML., Bakker MJ., Hengeveld R., Janssen L., Cresswell P., Egan DA., van Ham M., Ten Brinke A., Ovaa H., Beijersbergen RL., Kuijl C., Neefjes J. GTP loading tracked using 32P-ATP. kuijl.coenraad@gene.com, j.neefjes@nki.nl 26-Sep-2011: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Paul P., van den Hoorn T., Jongsma ML., Bakker MJ., Hengeveld R., Janssen L., Cresswell P., Egan DA., van Ham M., Ten Brinke A., Ovaa H., Beijersbergen RL., Kuijl C., Neefjes J. GTP loading tracked using 32P-ATP. kuijl.coenraad@gene.com, j.neefjes@nki.nl Accepted 2011-JUL-06 by JYOTI 26-Sep-2011: Contacted by JYOTI. Cell (0092-8674) 2011 jyoti Only protein-protein interactions imex curation A Genome-wide multidimensional RNAi screen reveals pathways controlling MHC class II antigen presentation. A Genome-wide multidimensional RNAi screen reveals pathways controlling MHC class II antigen presentation. Cell (0092-8674) 2011 imex curation Paul P., van den Hoorn T., Jongsma ML., Bakker MJ., Hengeveld R., Janssen L., Cresswell P., Egan DA., van Ham M., Ten Brinke A., Ovaa H., Beijersbergen RL., Kuijl C., Neefjes J. GTP loading tracked using 32P-ATP. kuijl.coenraad@gene.com, j.neefjes@nki.nl 26-Sep-2011: Contacted by JYOTI. jyoti Only protein-protein interactions human-mel_juso Homo sapiens mel_juso fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Paul P., van den Hoorn T., Jongsma ML., Bakker MJ., Hengeveld R., Janssen L., Cresswell P., Egan DA., van Ham M., Ten Brinke A., Ovaa H., Beijersbergen RL., Kuijl C., Neefjes J. GTP loading tracked using 32P-ATP. kuijl.coenraad@gene.com, j.neefjes@nki.nl Accepted 2011-JUL-06 by JYOTI 26-Sep-2011: Contacted by JYOTI. Cell (0092-8674) 2011 jyoti Only protein-protein interactions imex curation A Genome-wide multidimensional RNAi screen reveals pathways controlling MHC class II antigen presentation. A Genome-wide multidimensional RNAi screen reveals pathways controlling MHC class II antigen presentation. Cell (0092-8674) 2011 imex curation Paul P., van den Hoorn T., Jongsma ML., Bakker MJ., Hengeveld R., Janssen L., Cresswell P., Egan DA., van Ham M., Ten Brinke A., Ovaa H., Beijersbergen RL., Kuijl C., Neefjes J. GTP loading tracked using 32P-ATP. kuijl.coenraad@gene.com, j.neefjes@nki.nl 26-Sep-2011: Contacted by JYOTI. jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Paul P., van den Hoorn T., Jongsma ML., Bakker MJ., Hengeveld R., Janssen L., Cresswell P., Egan DA., van Ham M., Ten Brinke A., Ovaa H., Beijersbergen RL., Kuijl C., Neefjes J. GTP loading tracked using 32P-ATP. kuijl.coenraad@gene.com, j.neefjes@nki.nl Accepted 2011-JUL-06 by JYOTI 26-Sep-2011: Contacted by JYOTI. Cell (0092-8674) 2011 jyoti Only protein-protein interactions imex curation A Genome-wide multidimensional RNAi screen reveals pathways controlling MHC class II antigen presentation. A Genome-wide multidimensional RNAi screen reveals pathways controlling MHC class II antigen presentation. Cell (0092-8674) 2011 imex curation Paul P., van den Hoorn T., Jongsma ML., Bakker MJ., Hengeveld R., Janssen L., Cresswell P., Egan DA., van Ham M., Ten Brinke A., Ovaa H., Beijersbergen RL., Kuijl C., Neefjes J. GTP loading tracked using 32P-ATP. kuijl.coenraad@gene.com, j.neefjes@nki.nl 26-Sep-2011: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro gdp_gtp exchange gdp/gtp exchange assay gtp/gdp exchange guanine nucleotide exchange assay gtp/gdp exchange guanine nucleotide exchange assay gdp_gtp exchange predetermined predetermined participant predetermined Paul P., van den Hoorn T., Jongsma ML., Bakker MJ., Hengeveld R., Janssen L., Cresswell P., Egan DA., van Ham M., Ten Brinke A., Ovaa H., Beijersbergen RL., Kuijl C., Neefjes J. GTP loading tracked using 32P-ATP. kuijl.coenraad@gene.com, j.neefjes@nki.nl Accepted 2011-JUL-06 by JYOTI 26-Sep-2011: Contacted by JYOTI. Cell (0092-8674) 2011 jyoti Only protein-protein interactions imex curation A Genome-wide multidimensional RNAi screen reveals pathways controlling MHC class II antigen presentation. A Genome-wide multidimensional RNAi screen reveals pathways controlling MHC class II antigen presentation. Cell (0092-8674) 2011 imex curation Paul P., van den Hoorn T., Jongsma ML., Bakker MJ., Hengeveld R., Janssen L., Cresswell P., Egan DA., van Ham M., Ten Brinke A., Ovaa H., Beijersbergen RL., Kuijl C., Neefjes J. GTP loading tracked using 32P-ATP. kuijl.coenraad@gene.com, j.neefjes@nki.nl 26-Sep-2011: Contacted by JYOTI. jyoti Only protein-protein interactions human-mel_juso Homo sapiens mel_juso anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Paul P., van den Hoorn T., Jongsma ML., Bakker MJ., Hengeveld R., Janssen L., Cresswell P., Egan DA., van Ham M., Ten Brinke A., Ovaa H., Beijersbergen RL., Kuijl C., Neefjes J. GTP loading tracked using 32P-ATP. kuijl.coenraad@gene.com, j.neefjes@nki.nl Accepted 2011-JUL-06 by JYOTI 26-Sep-2011: Contacted by JYOTI. Cell (0092-8674) 2011 jyoti Only protein-protein interactions imex curation pi5p 1-phosphatidyl-1D-myo-inositol 5-phosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) pi3p 1-phosphatidyl-1D-myo-inositol 3-phosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) 1-phosphatidyl-1d-myo-inositol 3,4,5-trisphosphate 1-phosphatidyl-1D-myo-inositol 3,4,5-trisphosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) psd4_human PH and SEC7 domain-containing protein 4 PSD4 EFA6B TIC Pleckstrin homology and SEC7 domain-containing protein 4 Telomeric of interleukin-1 cluster protein Exchange factor for ADP-ribosylation factor guanine nucleotide factor 6 B protein protein human Homo sapiens Human MMGDYRLPDHPQPMEILNLYLGDSLEPHPGECPRETCSHEDPPEPFEEQTWATDPPEPTRQNVPPWGSGVELTHLGSWVHQDGLEPCQEQTRATDPPESTRQDAPPWGSGVELTHLGSPSAQREHRQNTASPGSPVNSHLPGSPKQNRSTSTQVVFWAGILQAQMCVLDLEEELEKTEGLKAGLKCCLPTPPVDLPGDTGLHSSPPENEDSGEDSSEPEGEGQAWLREGTPDSSPQWGAEEESMFFSNPLFLASPCSENSASGECFSWGASDSHAGVRTGPESPATLEPPLPEDTVLWELESEPDLGDGAAISGHCTPPFPVPIYKPHSICWASVAAAEGAPAAPPGHGESEGDRLGPAPSAAPCVDEALTWESGCVGSDLGPAAHPVQPWASLSPEGWQRGGPFWPQVTLNSQDRDEREGGHPQESLPCTLAPCPWRSPASSPEPSSPESESRGPGPRPSPASSQEGSPQLQHHSSGILPKWTLDASQSSLLETDGEQPSSLKKKEAGEAPKPGEEVKSEGTARPAETGDVQPDIHLTSAEHENLRTPMNSSWLPGSPMPQAQSPEEGQRPPAGDKLANGVRNNKVAWNLASRLYRLEGFRKSEVAAYLQKNNDFSRAVAEEYLSFFQFGGQSLDRALRSFLQALVLSGETQERERILYQFSRRFHHCNPGIFPSVDSVHTLTCAIMLLNTDLHGQNIGKSMSCQEFITNLNGLRDGGNFPKELLKALYWSIRSEKLEWAVDEEDTARPEKAQPSLPAGKMSKPFLQLAQDPTVPTYKQGILARKMHQDADGKKTPWGKRGWKMFHTLLRGMVLYFLKQGEDHCLEGESLVGQMVDEPVGVHHSLATPATHYTKKPHVFQLRTADWRLYLFQAPTAKEMSSWIARINLAAATHSAPPFPAAVGSQRRFVRPILPVGPAQSSLEEQHRSHENCLDAAADDLLDLQRNLPERRGRGRELEEHRLRKEYLEYEKTRYETYVQLLVARLHCPSDALDLWEEQLGREAGGTREPKLSLKKSHSSPSLHQDEAPTTAKVKRNISERRTYRKIIPKRNRNQL C1FC0F22DB596116 pi51a_human Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha PIP5K1A 68 kDa type I phosphatidylinositol 4-phosphate 5-kinase alpha Phosphatidylinositol 4-phosphate 5-kinase type I alpha protein protein human Homo sapiens Human MASASSGPSSSVGFSSFDPAVPSCTLSSAASGIKRPMASEVLEARQDSYISLVPYASGMPIKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELCSSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREKPLPTFKDLDFLQDIPDGLFLDADMYNALCKTLQRDCLVLQSFKIMDYSLLMSIHNIDHAQREPLSSETQYSVDTRRPAPQKALYSTAMESIQGEARRGGTMETDDHMGGIPARNSKGERLLLYIGIIDILQSYRFVKKLEHSWKALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSPSKKFRSGSSFSRRAGSSGNSCITYQPSVSGEHKAQVTTKAEVEPGVHLGRPDVLPQTPPLEEISEGSPIPDPSFSPLVGETLQMLTTSTTLEKLEVAESEFTH DIP protein Q99755 original sequence version: 117 A8F7988EB73506A0 myo1e_human Unconventional myosin-Ie Myosin-Ic MYO1E MYO1C Unconventional myosin 1E protein protein human Homo sapiens Human MGSKGVYQYHWQSHNVKHSGVDDMVLLSKITENSIVENLKKRYMDDYIFTYIGSVLISVNPFKQMPYFGEKEIEMYQGAAQYENPPHIYALADNMYRNMIIDRENQCVIISGESGAGKTVAAKYIMSYISRVSGGGTKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSPGGEPDGGKISNFLLEKSRVVMRNPGERSFHIFYQLIEGASAEQKHSLGITSMDYYYYLSLSGSYKVDDIDDRREFQETLHAMNVIGIFAEEQTLVLQIVAGILHLGNISFKEVGNYAAVESEEFLAFPAYLLGINQDRLKEKLTSRQMDSKWGGKSESIHVTLNVEQACYTRDALAKALHARVFDFLVDSINKAMEKDHEEYNIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIRWTPIEYFNNKIVCDLIENKVNPPGIMSILDDVCATMHAVGEGADQTLLQKLQMQIGSHEHFNSWNQGFIIHHYAGKVSYDMDGFCERNRDVLFMDLIELMQSSELPFIKSLFPENLQADKKGRPTTAGSKIKKQANDLVSTLMKCTPHYIRCIKPNETKKPRDWEESRVKHQVEYLGLKENIRVRRAGYAYRRIFQKFLQRYAILTKATWPSWQGEEKQGVLHLLQSVNMDSDQFQLGRSKVFIKAPESLFLLEEMRERKYDGYARVIQKSWRKFVARKKYVQMREEASDLLLNKKERRRNSINRNFIGDYIGMEEHPELQQFVGKREKIDFADTVTKYDRRFKGVKRDLLLTPKCLYLIGREKVKQGPDKGLVKEVLKRKIEIERILSVSLSTMQDDIFILHEQEYDSLLESVFKTEFLSLLAKRYEEKTQKQLPLKFSNTLELKLKKENWGPWSAGGSRQVQFHQGFGDLAVLKPSNKVLQVSIGPGLPKNSRPTRRNTTQNTGYSSGTQNANYPVRAAPPPPGYHQNGVIRNQYVPYPHAPGSQRSNQKSLYTSMARPPLPRQQSTSSDRVSQTPESLDFLKVPDQGAAGVRRQTTSRPPPAGGRPKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDIIDIIKEDPSGWWTGRLRGKQGLFPNNYVTKI phosphatidic acids phosphatidic acids small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) 1-phosphatidyl-1d-myo-inositol 3,4-bisphosphate 1-phosphatidyl-1D-myo-inositol 3,4-bisphosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) 1-phosphatidyl-1d-myo-inositol 4-phosphate 1-phosphatidyl-1D-myo-inositol 4-phosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) 1-phosphatidyl-1d-myo-inositol 4,5-bisphosphate 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) al14e_human ARL14 effector protein ARL14EP ARF7 effector protein ARF7EP C11orf46 protein protein human Homo sapiens Human MMDPCSVGVQLRTTNECHKTYYTRHTGFKTLQELSSNDMLLLQLRTGMTLSGNNTICFHHVKIYIDRFEDLQKSCCDPFNIHKKLAKKNLHVIDLDDATFLSAKFGRQLVPGWKLCPKCTQIINGSVDVDTEDRQKRKPESDGRTAKALRSLQFTNPGRQTEFAPETGKREKRRLTKNATAGSDRQVIPAKSKVYDSQGLLIFSGMDLCDCLDEDCLGCFYACPACGSTKCGAECRCDRKWLYEQIEIEGGEIIHNKHAG 18B70E7DB57B3252 arf6_human ADP-ribosylation factor 6 ARF6 protein protein human Homo sapiens Human MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS DIP protein P62330 original sequence version: 126 DIP protein P62330 original sequence version: 113 DIP protein P62330 original sequence version: 105 49E38E59AEA52B98 arl14_human ADP-ribosylation factor-like protein 14 ARL14 ARF7 ADP-ribosylation factor 7 protein protein human Homo sapiens Human MGSLGSKNPQTKQAQVLLLGLDSAGKSTLLYKLKLAKDITTIPTIGFNVEMIELERNLSLTVWDVGGQEKMRTVWGCYCENTDGLVYVVDSTDKQRLEESQRQFEHILKNEHIKNVPVVLLANKQDMPGALTAEDITRMFKVKKLCSDRNWYVQPCCALTGEGLAQGFRKLTGFVKSHMKSRGDTLAFFKQN DAA099214D8400DF 1-phosphatidyl-1d-myo-inositol 3,5-bisphosphate 1-phosphatidyl-1D-myo-inositol 3,5-bisphosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) arl14-psd4 6 20 acceptor acceptor neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 donor donor neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction 7B arf6-psd4 6 11 donor donor neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 19 acceptor acceptor neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction 7B 1_phosphatidyl_-psd4 2 15 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ph region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. direct interaction direct interaction Fig. 7C 1_phosphatidy-psd4-1 2 21 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ph region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. direct interaction direct interaction Fig. 7C 1_phosphatidy-psd4-2 2 11 unspecified role unspecified role prey prey ph region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 17 unspecified role unspecified role bait bait direct interaction direct interaction Fig. 7C phosphatidic_ac-psd4 2 14 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey ph region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. direct interaction direct interaction Fig. 7C 1_phosphatidy-psd4-3 2 11 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ph region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 9 unspecified role unspecified role bait bait direct interaction direct interaction Fig. 7C 1_phosphatidy-psd4-4 2 11 unspecified role unspecified role prey prey ph region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 8 unspecified role unspecified role bait bait direct interaction direct interaction Fig. 7C 1_phosphatidy-psd4-5 2 11 unspecified role unspecified role prey prey ph region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 16 unspecified role unspecified role bait bait direct interaction direct interaction Fig. 7C 1_phosphatidy-psd4-6 2 11 unspecified role unspecified role prey prey ph region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 10 unspecified role unspecified role bait bait direct interaction direct interaction Fig. 7C arl14-c11orf46 7 20 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 7E arl14-c11orf46-2 4 18 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 7F c11orf46-myo1e 3 13 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 18 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 7E c11orf46-myo1e-1 1 18 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Fig. 7I arl14-c11orf46-3 5 20 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 18 unspecified role unspecified role prey prey physical association physical association Supp. Table 7 arl14-pip5k1a 4 20 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 7F