MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it RB regulates pancreas development by stabilizing Pdx1. RB regulates pancreas development by stabilizing Pdx1. EMBO J. (0261-4189) 2011 imex curation Kim YC., Kim SY., Mellado-Gil JM., Yadav H., Neidermyer W., Kamaraju AK., Rane SG. Only protein-protein interactions mouse-min6 Mouse-pancreatic insulinoma cells min6 Cellline established from insulinomas retaining pancreatic beta cell characteristics These are obtained by targeted expression of the simian virus 40 T antigen gene in transgenic mice and have insulin promoter followed by SV40T antigene and produce insulin and T antigen. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim YC., Kim SY., Mellado-Gil JM., Yadav H., Neidermyer W., Kamaraju AK., Rane SG. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation pdx1_mouse Pancreas/duodenum homeobox protein 1 Pdx1 Ipf1 Insulin promoter factor 1 Islet/duodenum homeobox 1 Somatostatin-transactivating factor 1 protein protein mouse Mus musculus Mouse MNSEEQYYAATQLYKDPCAFQRGPVPEFSANPPACLYMGRQPPPPPPPQFTSSLGSLEQGSPPDISPYEVPPLASDDPAGAHLHHHLPAQLGLAHPPPGPFPNGTEPGGLEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYTAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRSSGTPSGGGGGEEPEQDCAVTSGEELLAVPPLPPPGGAVPPGVPAAVREGLLPSGLSVSPQPSSIAPLRPQEPR mint Activates insulin and somatostatin gene transcription. Key regulator of islet peptide hormone expression but also responsible for the development of the pancreas, most probably by determining maturation and differentiation of common pancreatic precursor cells in the developing gut. Binds the DNA sequence 5'-CC[CT]TAATGGG-3' homomint A57D04569D14E3C4 rb_mouse Retinoblastoma-associated protein Rb1 Rb-1 pRb pp105 p110-RB1 protein protein mouse Mus musculus Mouse MPPKAPRRAAAAEPPPPPPPPPREDDPAQDSGPEELPLARLEFEEIEEPEFIALCQKLKVPDHVRERAWLTWEKVSSVDGILEGYIQKKKELWGICIFIAAVDLDEMPFTFTELQKSIETSVYKFFDLLKEIDTSTKVDNAMSRLLKKYNVLCALYSKLERTCELIYLTQPSSALSTEINSMLVLKISWITFLLAKGEVLQMEDDLVISFQLMLCVVDYFIKFSPPALLREPYKTAAIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFINSLGIVSSNGLPEVESLSKRYEEVYLKNKDLDARLFLDHDKTLQTDPIDSFETERTPRKNNPDEEANVVTPHTPVRTVMNTIQQLMVILNSASDQPSENLISYFNNCTVNPKENILKRVKDVGHIFKEKFANAVGQGCVDIGVQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTLQHLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKVEANLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDGEGPDNLEPACPLSLPLQGNHTAADMYLSPLRSPKKRTSTTRVNSAANTETQAASAFHTQKPLKSTSLALFYKKVYRLAYLRLNTLCARLLSDHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAAQETFKRVLIREEEFDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFSSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGGNPPKPLKKLRFDIEGADEADGSKHLPAESKFQQKLAEMTSTRTRMQKQRMNESKDVSNKEEK DIP protein P13405 original sequence version: 115 DIP protein P13405 original sequence version: 114 DIP protein P13405 original sequence version: 110 AE81D35A07ADB493 pdx1-rb1 1 Pdx1 2 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Rb 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level phosphorylated phosphorylated residue phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain prerequisite-ptm physical association physical association homomint mint Co-immunoprecipitation analyses revealed increased RB/Pdx-1 interaction in Cdk4R/R islets, compared with that observed in Cdk4WT islets (Figure 2D). co-immunoprecipitation analyses revealed RB/Pdx-1 interaction in cells deprived of glucose or those cultured in 3mM glucose, whereas a weak RB/Pdx-1 interaction was observed in cells stimulated with 25mM glucose (Figure 5F). Interestingly, culture for 24 h in either 3 or 25mM glucose resulted in reduced RB/Pdx-1 interaction (Figure 5G). Of note, in both the 2- and 24-h experimental conditions, Pdx-1 was observed to associate with the slower migrating phosphorylated form of RB and not with underphosphorylated RB (Figure 5F and G). The same interaction occurs in cdk4 islets and beta-HC9 cells. f1c sf1b f2b f2d f2e f5g f5f rb1-pdx1 1 Pdx1 2 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Rb 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f1d homomint mint