IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Angiopoietin-like 4 Protein Elevates the Prosurvival Intracellular O(2)(-):H(2)O(2) Ratio and Confers Anoikis Resistance to Tumors. Angiopoietin-like 4 Protein Elevates the Prosurvival Intracellular O(2)(-):H(2)O(2) Ratio and Confers Anoikis Resistance to Tumors. Cancer Cell (1535-6108) 2011 imex curation Zhu P., Tan MJ., Huang RL., Tan CK., Chong HC., Pal M., Lam CR., Boukamp P., Pan JY., Tan SH., Kersten S., Li HY., Ding JL., Tan NS. All interactions were reduced in A-5RT3 (ANGPTL4)-induced tumors (Figure 3K). Cells used were from A-5RT3(CTRL) and A-5RT3 (ANGPTL4) tumour biopsies. The former line contains a stably integrated non-targeting scrambled siRNA, as a control line, and the A-5RT3 (ANGPTL4) line contains an siRNA targeting a segment of the ANGPTL4 sequence. As a result mRNA and protein levels of ANGPTL4 were suppressed by >85% in the A-5RT3 (ANGPTL4) cell line, as compared to the control line. Details of ANGPTL4 were obtained from Goh et al.,JBC 285, 2010. The authors confirm that integrins beta-1 and beta 5 were of human origin. nstan@ntu.edu.sg 06-Jun-2011: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Zhu P., Tan MJ., Huang RL., Tan CK., Chong HC., Pal M., Lam CR., Boukamp P., Pan JY., Tan SH., Kersten S., Li HY., Ding JL., Tan NS. All interactions were reduced in A-5RT3 (ANGPTL4)-induced tumors (Figure 3K). Cells used were from A-5RT3(CTRL) and A-5RT3 (ANGPTL4) tumour biopsies. The former line contains a stably integrated non-targeting scrambled siRNA, as a control line, and the A-5RT3 (ANGPTL4) line contains an siRNA targeting a segment of the ANGPTL4 sequence. As a result mRNA and protein levels of ANGPTL4 were suppressed by >85% in the A-5RT3 (ANGPTL4) cell line, as compared to the control line. Details of ANGPTL4 were obtained from Goh et al.,JBC 285, 2010. The authors confirm that integrins beta-1 and beta 5 were of human origin. nstan@ntu.edu.sg Accepted 2011-APR-19 by JYOTI 06-Jun-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 jyoti Only protein-protein interactions imex curation Angiopoietin-like 4 Protein Elevates the Prosurvival Intracellular O(2)(-):H(2)O(2) Ratio and Confers Anoikis Resistance to Tumors. Angiopoietin-like 4 Protein Elevates the Prosurvival Intracellular O(2)(-):H(2)O(2) Ratio and Confers Anoikis Resistance to Tumors. Cancer Cell (1535-6108) 2011 imex curation Zhu P., Tan MJ., Huang RL., Tan CK., Chong HC., Pal M., Lam CR., Boukamp P., Pan JY., Tan SH., Kersten S., Li HY., Ding JL., Tan NS. All interactions were reduced in A-5RT3 (ANGPTL4)-induced tumors (Figure 3K). Cells used were from A-5RT3(CTRL) and A-5RT3 (ANGPTL4) tumour biopsies. The former line contains a stably integrated non-targeting scrambled siRNA, as a control line, and the A-5RT3 (ANGPTL4) line contains an siRNA targeting a segment of the ANGPTL4 sequence. As a result mRNA and protein levels of ANGPTL4 were suppressed by >85% in the A-5RT3 (ANGPTL4) cell line, as compared to the control line. Details of ANGPTL4 were obtained from Goh et al.,JBC 285, 2010. The authors confirm that integrins beta-1 and beta 5 were of human origin. nstan@ntu.edu.sg 06-Jun-2011: Contacted by JYOTI. jyoti Only protein-protein interactions human-a5rt3 Human metastatic skin keratinocyte cell line , A5RT3 or A-5RT3. a5rt3 Human metastatic skin keratinocyte cell line , A5RT3 or A-5RT3 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhu P., Tan MJ., Huang RL., Tan CK., Chong HC., Pal M., Lam CR., Boukamp P., Pan JY., Tan SH., Kersten S., Li HY., Ding JL., Tan NS. All interactions were reduced in A-5RT3 (ANGPTL4)-induced tumors (Figure 3K). Cells used were from A-5RT3(CTRL) and A-5RT3 (ANGPTL4) tumour biopsies. The former line contains a stably integrated non-targeting scrambled siRNA, as a control line, and the A-5RT3 (ANGPTL4) line contains an siRNA targeting a segment of the ANGPTL4 sequence. As a result mRNA and protein levels of ANGPTL4 were suppressed by >85% in the A-5RT3 (ANGPTL4) cell line, as compared to the control line. Details of ANGPTL4 were obtained from Goh et al.,JBC 285, 2010. The authors confirm that integrins beta-1 and beta 5 were of human origin. nstan@ntu.edu.sg Accepted 2011-APR-19 by JYOTI 06-Jun-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 jyoti Only protein-protein interactions imex curation Angiopoietin-like 4 Protein Elevates the Prosurvival Intracellular O(2)(-):H(2)O(2) Ratio and Confers Anoikis Resistance to Tumors. Angiopoietin-like 4 Protein Elevates the Prosurvival Intracellular O(2)(-):H(2)O(2) Ratio and Confers Anoikis Resistance to Tumors. Cancer Cell (1535-6108) 2011 imex curation Zhu P., Tan MJ., Huang RL., Tan CK., Chong HC., Pal M., Lam CR., Boukamp P., Pan JY., Tan SH., Kersten S., Li HY., Ding JL., Tan NS. All interactions were reduced in A-5RT3 (ANGPTL4)-induced tumors (Figure 3K). Cells used were from A-5RT3(CTRL) and A-5RT3 (ANGPTL4) tumour biopsies. The former line contains a stably integrated non-targeting scrambled siRNA, as a control line, and the A-5RT3 (ANGPTL4) line contains an siRNA targeting a segment of the ANGPTL4 sequence. As a result mRNA and protein levels of ANGPTL4 were suppressed by >85% in the A-5RT3 (ANGPTL4) cell line, as compared to the control line. Details of ANGPTL4 were obtained from Goh et al.,JBC 285, 2010. The authors confirm that integrins beta-1 and beta 5 were of human origin. nstan@ntu.edu.sg 06-Jun-2011: Contacted by JYOTI. jyoti Only protein-protein interactions human-a5rt3 Human metastatic skin keratinocyte cell line , A5RT3 or A-5RT3. a5rt3 Human metastatic skin keratinocyte cell line , A5RT3 or A-5RT3 pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Zhu P., Tan MJ., Huang RL., Tan CK., Chong HC., Pal M., Lam CR., Boukamp P., Pan JY., Tan SH., Kersten S., Li HY., Ding JL., Tan NS. All interactions were reduced in A-5RT3 (ANGPTL4)-induced tumors (Figure 3K). have deleted the second "journal entry" in the hope I could re-add Curation Depth - "imex curation" - but Curation Depth still is not visible on the drop-down-menu, and presumably never is, as comes from Publication page.... cant get rid of 2 "journals" as Bottom TOPIC - have emailed Bruno... I is needed as Imex Curation - not journal = cannot find "curation Depth" on drop-down menu. Cells used were from A-5RT3(CTRL) and A-5RT3 (ANGPTL4) tumour biopsies. The former line contains a stably integrated non-targeting scrambled siRNA, as a control line, and the A-5RT3 (ANGPTL4) line contains an siRNA targeting a segment of the ANGPTL4 sequence. As a result mRNA and protein levels of ANGPTL4 were suppressed by >85% in the A-5RT3 (ANGPTL4) cell line, as compared to the control line. Details of ANGPTL4 were obtained from Goh et al.,JBC 285, 2010. The authors confirm that integrins beta-1 and beta 5 were of human origin. Details of ANGPTL4 were obtained from Goh et al.,JBC 285, 2010. The authors confirm that integrins beta-1 and beta 5 were of human origin. nstan@ntu.edu.sg Accepted 2011-APR-19 by JYOTI 06-Jun-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 jyoti Only protein-protein interactions imex curation itb5_human Integrin beta-5 ITGB5 protein protein human Homo sapiens Human MPRAPAPLYACLLGLCALLPRLAGLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSITSRCDLRANLVKNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRPGDKTTFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDNIRSLGTKLAEEMRKLTSNFRLGFGSFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVSRNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQCHLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEILDGDSKNIIQLIINAYNSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGDTASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSGTYVCGLCECSPGYLGTRCECQDGENQSVYQNLCREAEGKPLCSGRGDCSCNQCSCFESEFGKIYGPFCECDNFSCARNKGVLCSGHGECHCGECKCHAGYIGDNCNCSTDISTCRGRDGQICSERGHCLCGQCQCTEPGAFGEMCEKCPTCPDACSTKRDCVECLLLHSGKPDNQTCHSLCRDEVITWVDTIVKDDQEAVLCFYKTAKDCVMMFTYVELPSGKSNLTVLREPECGNTPNAMTILLAVVGSILLVGLALLAIWKLLVTIHDRREFAKFQSERSRARYEMASNPLYRKPISTHTVDFTFNKFNKSYNGTVD D7E4727CA310512B angl4_human Angiopoietin-related protein 4 ANGPTL4 ARP4 HFARP PGAR Angiopoietin-like protein 4 Hepatic fibrinogen/angiopoietin-related protein PP1158 PSEC0166 UNQ171/PRO197 protein protein human Homo sapiens Human MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS 219E56FEB3F602AF rac1_human Ras-related C3 botulinum toxin substrate 1 RAC1 MIG5 p21-Rac1 Ras-like protein TC25 Cell migration-inducing gene 5 protein TC25 protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL ACEDF83A45E5EA67 itb1_human Integrin beta-1 Fibronectin receptor subunit beta VLA-4 subunit beta ITGB1 FNRB MDF2 MSK12 Glycoprotein IIa protein protein human Homo sapiens Human MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCEASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK DIP protein P05556 original sequence version: 139 DIP protein P05556-1 original sequence version: 143 DIP protein P05556 original sequence version: 154 DIP protein P05556 original sequence version: 167 DE35979C1625578C fak1_human Focal adhesion kinase 1 PTK2 FAK FAK1 pp125FAK Protein-tyrosine kinase 2 Focal adhesion kinase-related nonkinase Protein phosphatase 1 regulatory subunit 71 p125FAK protein protein human Homo sapiens Human MAAAYLDPNLNHTPNSSTKTHLGTGMERSPGAMERVLKVFHYFESNSEPTTWASIIRHGDATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSYWEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFIIRPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKAQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNEGVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTRPH D8A4C15138AB0243 angptl4-itgb1 1 5 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range fibrinogen_c-terminal_domain sufficient to bind sufficient binding region sufficient to bind range range range range drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 7 unspecified role unspecified role prey prey direct interaction direct interaction Figs 3E, 3G. The KD was determined to be "about 10−7 M". mAb11F6C4. angptl4-itgb5 1 5 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range fibrinogen_c-terminal_domain sufficient to bind sufficient binding region sufficient to bind range range range range drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 4 unspecified role unspecified role prey prey direct interaction direct interaction Figs 3F, 3H. The KD was determined to be "about 10−7 M". mAb11F6C4. angptl4-itgb5-4 2 6 unspecified role unspecified role prey prey gtp-rac biological feature biological feature undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey p397_tyr optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey association association Fig 3K. I have added the gtp bound Rac1 as a "biological feature" as I cannot think of anything better... angptl4-itgb1-2 3 7 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction Fig 3I, S3I. I cannot see any place given for the co-localisation relating to any figure - it is certainly not nuclear... angptl4-itgb5-6 3 5 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction Fig 3I, S3I.