IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ CD44 Variant Regulates Redox Status in Cancer Cells by Stabilizing the xCT Subunit of System xc(-) and Thereby Promotes Tumor Growth. CD44 Variant Regulates Redox Status in Cancer Cells by Stabilizing the xCT Subunit of System xc(-) and Thereby Promotes Tumor Growth. Cancer Cell (1535-6108) 2011 imex curation Ishimoto T., Nagano O., Yae T., Tamada M., Motohara T., Oshima H., Oshima M., Ikeda T., Asaba R., Yagi H., Masuko T., Shimizu T., Ishikawa T., Kai K., Takahashi E., Imamura Y., Baba Y., Ohmura M., Suematsu M., Baba H., Saya H. Tissue sections and cells were viewed with a Biorevo BZ-9000 fluorescence microscope (Keyence) or an FV1000-D confocal microscope (Olympus, Tokyo, Japan). osmna@sb3.so-net.ne.jp jyoti Only protein-protein interactions human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ishimoto T., Nagano O., Yae T., Tamada M., Motohara T., Oshima H., Oshima M., Ikeda T., Asaba R., Yagi H., Masuko T., Shimizu T., Ishikawa T., Kai K., Takahashi E., Imamura Y., Baba Y., Ohmura M., Suematsu M., Baba H., Saya H. Tissue sections and cells were viewed with a Biorevo BZ-9000 fluorescence microscope (Keyence) or an FV1000-D confocal microscope (Olympus, Tokyo, Japan). osmna@sb3.so-net.ne.jp Accepted 2011-MAR-29 by JYOTI Cancer Cell (1535-6108) 2011 jyoti Only protein-protein interactions imex curation CD44 Variant Regulates Redox Status in Cancer Cells by Stabilizing the xCT Subunit of System xc(-) and Thereby Promotes Tumor Growth. CD44 Variant Regulates Redox Status in Cancer Cells by Stabilizing the xCT Subunit of System xc(-) and Thereby Promotes Tumor Growth. Cancer Cell (1535-6108) 2011 imex curation Ishimoto T., Nagano O., Yae T., Tamada M., Motohara T., Oshima H., Oshima M., Ikeda T., Asaba R., Yagi H., Masuko T., Shimizu T., Ishikawa T., Kai K., Takahashi E., Imamura Y., Baba Y., Ohmura M., Suematsu M., Baba H., Saya H. Tissue sections and cells were viewed with a Biorevo BZ-9000 fluorescence microscope (Keyence) or an FV1000-D confocal microscope (Olympus, Tokyo, Japan). osmna@sb3.so-net.ne.jp jyoti Only protein-protein interactions human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Ishimoto T., Nagano O., Yae T., Tamada M., Motohara T., Oshima H., Oshima M., Ikeda T., Asaba R., Yagi H., Masuko T., Shimizu T., Ishikawa T., Kai K., Takahashi E., Imamura Y., Baba Y., Ohmura M., Suematsu M., Baba H., Saya H. Tissue sections and cells were viewed with a Biorevo BZ-9000 fluorescence microscope (Keyence) or an FV1000-D confocal microscope (Olympus, Tokyo, Japan). osmna@sb3.so-net.ne.jp Accepted 2011-MAR-29 by JYOTI Cancer Cell (1535-6108) 2011 jyoti Only protein-protein interactions imex curation CD44 Variant Regulates Redox Status in Cancer Cells by Stabilizing the xCT Subunit of System xc(-) and Thereby Promotes Tumor Growth. CD44 Variant Regulates Redox Status in Cancer Cells by Stabilizing the xCT Subunit of System xc(-) and Thereby Promotes Tumor Growth. Cancer Cell (1535-6108) 2011 imex curation Ishimoto T., Nagano O., Yae T., Tamada M., Motohara T., Oshima H., Oshima M., Ikeda T., Asaba R., Yagi H., Masuko T., Shimizu T., Ishikawa T., Kai K., Takahashi E., Imamura Y., Baba Y., Ohmura M., Suematsu M., Baba H., Saya H. Tissue sections and cells were viewed with a Biorevo BZ-9000 fluorescence microscope (Keyence) or an FV1000-D confocal microscope (Olympus, Tokyo, Japan). osmna@sb3.so-net.ne.jp jyoti Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ishimoto T., Nagano O., Yae T., Tamada M., Motohara T., Oshima H., Oshima M., Ikeda T., Asaba R., Yagi H., Masuko T., Shimizu T., Ishikawa T., Kai K., Takahashi E., Imamura Y., Baba Y., Ohmura M., Suematsu M., Baba H., Saya H. Tissue sections and cells were viewed with a Biorevo BZ-9000 fluorescence microscope (Keyence) or an FV1000-D confocal microscope (Olympus, Tokyo, Japan). osmna@sb3.so-net.ne.jp Accepted 2011-MAR-29 by JYOTI Cancer Cell (1535-6108) 2011 jyoti Only protein-protein interactions imex curation cd44_human CD44 antigen Epican CDw44 Phagocytic glycoprotein I Extracellular matrix receptor III HUTCH-I Phagocytic glycoprotein 1 GP90 lymphocyte homing/adhesion receptor Hermes antigen Hyaluronate receptor Heparan sulfate proteoglycan CD44 LHR MDU2 MDU3 MIC4 protein protein human Homo sapiens Human MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNEENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWNPEAHPPLIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSITLQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDVTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKSQEMVHLVNKESSETPDQFMTADETRNLQNVDMKIGV DIP protein P16070 original sequence version: 142 DIP protein P16070 original sequence version: 157 BB9B66B19B970349 4f2_human 4F2 cell-surface antigen heavy chain Lymphocyte activation antigen 4F2 large subunit 4F2 heavy chain antigen SLC3A2 MDU1 Solute carrier family 3 member 2 protein protein human Homo sapiens Human MELQPPEASIAVVSIPRQLPGSHSEAGVQGLSAGDDSELGSHCVAQTGLELLASGDPLPSASQNAEMIETGSDCVTQAGLQLLASSDPPALASKNAEVTGTMSQDTEVDMKEVELNELEPEKQPMNAASGAAMSLAGAEKNGLVKIKVAEDEAEAAAAAKFTGLSKEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPAQKWWHTGALYRIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTLPGTPVFSYGDEIGLDAAALPGQPMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRRLSDQRSKERSLLHGDFHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQASDLPASASLPAKADLLLSTQPGREEGSPLELERLKLEPHEGLLLRFPYAA AE427F8204CC10B0 xct_human Cystine/glutamate transporter SLC7A11 Amino acid transport system xc- Calcium channel blocker resistance protein CCBR1 Solute carrier family 7 member 11 xCT protein protein human Homo sapiens Human MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL 3EF2648B94A9F59E cd44-xct 2 6 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig 5B. cd44-slc3a2 1 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey association association Fig 5E. xct-cd44 1 6 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Fig 5E. antibodies to xCT showed that xCT interacts preferentially with 130 kDa CD44v rather than with the 85 kDa CD44s isoform (Figure 5E). (no info is given regarding the identity of these isoforms, neither are any isoforms corresponding to these stated M.Wts listed in UniProt). The terms Cd44v and CD44s are earlier referred to as being the CD44v = Variant forms and CD44s = Standard forms - though this is clearly not what is meant in Fig 5E. (there are ~20++ isoforms many of which are not listed in UniProt) xct-cd44-1 3 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Fig 5F, 5G. The terms Cd44v and CD44s are earlier referred to as being the CD44v = Variant forms and CD44s = Standard forms - though this is clearly not what is meant in Fig 5E or here. (there are ~20++ isoforms many of which are not listed in UniProt) xCT specifically interacted with CD44v, not with CD44s (Figure 5F).