IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ PARIS (ZNF746) Repression of PGC-1α Contributes to Neurodegeneration in Parkinson's Disease. PARIS (ZNF746) Repression of PGC-1α Contributes to Neurodegeneration in Parkinson's Disease. Cell (0092-8674) 2011 imex curation Shin JH., Ko HS., Kang H., Lee Y., Lee YI., Pletinkova O., Troconso JC., Dawson VL., Dawson TM. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease Source of parkin taken from manufacturer's website. tdawson@jhmi.edu 21-Dec-2011: Contacted by JYOTI. jyoti Only protein-protein interactions human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Shin JH., Ko HS., Kang H., Lee Y., Lee YI., Pletinkova O., Troconso JC., Dawson VL., Dawson TM. Parkinsons - Interactions investigated in the context of Parkinsons disease Source of parkin taken from manufacturer's website. tdawson@jhmi.edu Accepted 2011-SEP-21 by JYOTI Cell (0092-8674) 2011 jyoti Only protein-protein interactions imex curation PARIS (ZNF746) Repression of PGC-1α Contributes to Neurodegeneration in Parkinson's Disease. PARIS (ZNF746) Repression of PGC-1α Contributes to Neurodegeneration in Parkinson's Disease. Cell (0092-8674) 2011 imex curation Shin JH., Ko HS., Kang H., Lee Y., Lee YI., Pletinkova O., Troconso JC., Dawson VL., Dawson TM. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease Source of parkin taken from manufacturer's website. tdawson@jhmi.edu 21-Dec-2011: Contacted by JYOTI. jyoti Only protein-protein interactions human-brain Homo sapiens brain brain Brain [cerebrum] ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Shin JH., Ko HS., Kang H., Lee Y., Lee YI., Pletinkova O., Troconso JC., Dawson VL., Dawson TM. Parkinsons - Interactions investigated in the context of Parkinsons disease Source of parkin taken from manufacturer's website. tdawson@jhmi.edu Accepted 2011-SEP-21 by JYOTI 21-Dec-2011: Contacted by JYOTI. Cell (0092-8674) 2011 jyoti Only protein-protein interactions imex curation PARIS (ZNF746) Repression of PGC-1α Contributes to Neurodegeneration in Parkinson's Disease. PARIS (ZNF746) Repression of PGC-1α Contributes to Neurodegeneration in Parkinson's Disease. Cell (0092-8674) 2011 imex curation Shin JH., Ko HS., Kang H., Lee Y., Lee YI., Pletinkova O., Troconso JC., Dawson VL., Dawson TM. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease Source of parkin taken from manufacturer's website. tdawson@jhmi.edu 21-Dec-2011: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Shin JH., Ko HS., Kang H., Lee Y., Lee YI., Pletinkova O., Troconso JC., Dawson VL., Dawson TM. Parkinsons - Interactions investigated in the context of Parkinsons disease Source of parkin taken from manufacturer's website. tdawson@jhmi.edu Accepted 2011-SEP-21 by JYOTI 21-Dec-2011: Contacted by JYOTI. Cell (0092-8674) 2011 jyoti Only protein-protein interactions imex curation Have looked through the whole paper and the only time His-parkin is used, is in an in vitro ubiquitination assay. PARIS (ZNF746) Repression of PGC-1α Contributes to Neurodegeneration in Parkinson's Disease. PARIS (ZNF746) Repression of PGC-1α Contributes to Neurodegeneration in Parkinson's Disease. Cell (0092-8674) 2011 imex curation Shin JH., Ko HS., Kang H., Lee Y., Lee YI., Pletinkova O., Troconso JC., Dawson VL., Dawson TM. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease Source of parkin taken from manufacturer's website. tdawson@jhmi.edu 21-Dec-2011: Contacted by JYOTI. jyoti Only protein-protein interactions mouse-brain Mus musculus brain brain Brain [cerebrum] ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Shin JH., Ko HS., Kang H., Lee Y., Lee YI., Pletinkova O., Troconso JC., Dawson VL., Dawson TM. Parkinsons - Interactions investigated in the context of Parkinsons disease Source of parkin taken from manufacturer's website. tdawson@jhmi.edu Accepted 2011-SEP-21 by JYOTI 21-Dec-2011: Contacted by JYOTI. Cell (0092-8674) 2011 jyoti Only protein-protein interactions imex curation PARIS (ZNF746) Repression of PGC-1α Contributes to Neurodegeneration in Parkinson's Disease. PARIS (ZNF746) Repression of PGC-1α Contributes to Neurodegeneration in Parkinson's Disease. Cell (0092-8674) 2011 imex curation Shin JH., Ko HS., Kang H., Lee Y., Lee YI., Pletinkova O., Troconso JC., Dawson VL., Dawson TM. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease Source of parkin taken from manufacturer's website. tdawson@jhmi.edu 21-Dec-2011: Contacted by JYOTI. jyoti Only protein-protein interactions mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Shin JH., Ko HS., Kang H., Lee Y., Lee YI., Pletinkova O., Troconso JC., Dawson VL., Dawson TM. Parkinsons - Interactions investigated in the context of Parkinsons disease Source of parkin taken from manufacturer's website. tdawson@jhmi.edu Accepted 2011-SEP-21 by JYOTI 21-Dec-2011: Contacted by JYOTI. Cell (0092-8674) 2011 jyoti Only protein-protein interactions imex curation PARIS (ZNF746) Repression of PGC-1α Contributes to Neurodegeneration in Parkinson's Disease. PARIS (ZNF746) Repression of PGC-1α Contributes to Neurodegeneration in Parkinson's Disease. Cell (0092-8674) 2011 imex curation Shin JH., Ko HS., Kang H., Lee Y., Lee YI., Pletinkova O., Troconso JC., Dawson VL., Dawson TM. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease Source of parkin taken from manufacturer's website. tdawson@jhmi.edu 21-Dec-2011: Contacted by JYOTI. jyoti Only protein-protein interactions human-brain Homo sapiens brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Shin JH., Ko HS., Kang H., Lee Y., Lee YI., Pletinkova O., Troconso JC., Dawson VL., Dawson TM. Parkinsons - Interactions investigated in the context of Parkinsons disease Source of parkin taken from manufacturer's website. tdawson@jhmi.edu Accepted 2011-SEP-21 by JYOTI 21-Dec-2011: Contacted by JYOTI. Cell (0092-8674) 2011 jyoti Only protein-protein interactions imex curation PARIS (ZNF746) Repression of PGC-1α Contributes to Neurodegeneration in Parkinson's Disease. PARIS (ZNF746) Repression of PGC-1α Contributes to Neurodegeneration in Parkinson's Disease. Cell (0092-8674) 2011 imex curation Shin JH., Ko HS., Kang H., Lee Y., Lee YI., Pletinkova O., Troconso JC., Dawson VL., Dawson TM. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease Source of parkin taken from manufacturer's website. tdawson@jhmi.edu 21-Dec-2011: Contacted by JYOTI. jyoti Only protein-protein interactions human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Shin JH., Ko HS., Kang H., Lee Y., Lee YI., Pletinkova O., Troconso JC., Dawson VL., Dawson TM. Parkinsons - Interactions investigated in the context of Parkinsons disease Source of parkin taken from manufacturer's website. tdawson@jhmi.edu Accepted 2011-SEP-21 by JYOTI 21-Dec-2011: Contacted by JYOTI. Cell (0092-8674) 2011 jyoti Only protein-protein interactions imex curation PARIS (ZNF746) Repression of PGC-1α Contributes to Neurodegeneration in Parkinson's Disease. PARIS (ZNF746) Repression of PGC-1α Contributes to Neurodegeneration in Parkinson's Disease. Cell (0092-8674) 2011 imex curation Shin JH., Ko HS., Kang H., Lee Y., Lee YI., Pletinkova O., Troconso JC., Dawson VL., Dawson TM. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease Source of parkin taken from manufacturer's website. tdawson@jhmi.edu 21-Dec-2011: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Shin JH., Ko HS., Kang H., Lee Y., Lee YI., Pletinkova O., Troconso JC., Dawson VL., Dawson TM. Parkinsons - Interactions investigated in the context of Parkinsons disease Source of parkin taken from manufacturer's website. tdawson@jhmi.edu Accepted 2011-SEP-21 by JYOTI 21-Dec-2011: Contacted by JYOTI. Cell (0092-8674) 2011 jyoti Only protein-protein interactions imex curation prkn_human E3 ubiquitin-protein ligase parkin PRKN PARK2 Parkin RBR E3 ubiquitin-protein ligase Parkinson juvenile disease protein 2 protein protein human Homo sapiens Human MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV DIP protein O60260 original sequence version: 99 DIP protein O60260-1 original sequence version: 145 DIP protein O60260-1 original sequence version: 158 DIP protein O60260 original sequence version: 157 9A8BB802A3FC84C3 prkn_mouse E3 ubiquitin-protein ligase parkin Prkn Park2 Parkin RBR E3 ubiquitin-protein ligase protein protein mouse Mus musculus Mouse MIVFVRFNSSYGFPVEVDSDTSILQLKEVVAKRQGVPADQLRVIFAGKELPNHLTVQNCDLEQQSIVHIVQRPRRRSHETNASGGDEPQSTSEGSIWESRSLTRVDLSSHTLPVDSVGLAVILDTDSKRDSEAARGPVKPTYNSFFIYCKGPCHKVQPGKLRVQCGTCKQATLTLAQGPSCWDDVLIPNRMSGECQSPDCPGTRAEFFFKCGAHPTSDKDTSVALNLITSNRRSIPCIACTDVRSPVLVFQCNHRHVICLDCFHLYCVTRLNDRQFVHDAQLGYSLPCVAGCPNSLIKELHHFRILGEEQYTRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEQGQRKVTCEGGNGLGCGFVFCRDCKEAYHEGDCDSLLEPSGATSQAYRVDKRAAEQARWEEASKETIKKTTKPCPRCNVPIEKNGGCMHMKCPQPQCKLEWCWNCGCEWNRACMGDHWFDV DIP protein Q9WVS6 original sequence version: 126 5574A285A9A1B080 pckcg_human_gene Phosphoenolpyruvate carboxykinase, cytosolic [GTP] gene gene gene human Homo sapiens Human prgc1_human_gene Peroxisome proliferator-activated receptor gamma coactivator 1-alpha gene gene gene human Homo sapiens Human prgc1_mouse_gene Peroxisome proliferator-activated receptor gamma coactivator 1-alpha gene gene gene mouse Mus musculus Mouse irs1_ppargcia_human_dna irs1 region of PPARGC1a gene ss dna single stranded deoxyribonucleic acid ss DNA ss dna human Homo sapiens Human AGTGTGTTGGTATTTTTCCCTCAGTTC zn746_mouse Zinc finger protein 746 Znf746 Zfp746 protein protein mouse Mus musculus Mouse MAEAAAAPISPWTMAATIQAMERKIESQAARLLSLEGRTGMAEKKLADCEKTAVEFSNQLEGKWAVLGTLLQEYGLLQRRLENVENLLRNRNFWILRLPPGSKGEVPKEWGKLEDWQKELYKHVMRGNYETLVSLDYAISKPEVLSQIEQGKEPCTWRRTGPKVPEVPVDPSPGSGAPVPAPDLLMQIKQEGELQLQEQQALGVEAWAAGQPDIGEEPWGLSQLDSGAGDISTDATSGVHSNFSTTIPPTSWQADLPPHHPSSACSDGTLKLNTAASTEADVKIVIKTEVQEEEVVATPVHPTDLEAHGTLFAPGQATRFFPSPVQEGAWESQGSSFPSQDPVLGLREPTRPERDIGELSPAIAQEEAPAGDWLFGGVRWGWNFRCKPPVGLNPRTVPEGLPFSSPDNGEAILDPSQAPRPFNDPCKYPGRTKGFGHKPGLKKHPAAPPGGRPFTCATCGKSFQLQVSLSAHQRSCGLSDGAATGAASTTTGGGGGGSGGGGGSSGGGSSARDSSALRCGECGRCFTRPAHLIRHRMLHTGERPFPCTECEKRFTERSKLIDHYRTHTGVRPFTCTVCGKSFIRKDHLRKHQRNHPAVAKAPAHGQPLPPLPAPPDPFKSPAAKGPMASTDLVTDWTCGLSVLGPSDGGGDL 680CFF21F30CEDE0 irs2_ppargc1a_human_dna IRS2 region of PPARGC1A gene ss dna single stranded deoxyribonucleic acid ss DNA ss dna chemical synthesis Chemical synthesis (Chemical synthesis) ACATACAGGCTATTTTGTTGATTAAAC g6pc_human_gene Glucose-6-phosphatase gene gene gene human Homo sapiens Human zn746_human Zinc finger protein 746 PARIS ZNF746 Parkin-interacting substrate protein protein human Homo sapiens Human MAEAVAAPISPWTMAATIQAMERKIESQAARLLSLEGRTGMAEKKLADCEKTAVEFGNQLEGKWAVLGTLLQEYGLLQRRLENVENLLRNRNFWILRLPPGSKGESPKEWGKLEDWQKELYKHVMRGNYETLVSLDYAISKPEVLSQIEQGKEPCNWRRPGPKIPDVPVDPSPGSGPPVPAPDLLMQIKQEGELQLQEQQALGVEAWAAGQPDIGEEPWGLSQLDSGAGDISTDATSGVHSNFSTTIPPTSWQTDLPPHHPSSACSDGTLKLNTAASTEDVKIVIKTEVQEEEVVATPVHPTDLEAHGTLFGPGQATRFFPSPAQEGAWESQGSSFPSQDPVLGLREPARPERDMGELSPAVAQEETPPGDWLFGGVRWGWNFRCKPPVGLNPRTGPEGLPYSSPDNGEAILDPSQAPRPFNEPCKYPGRTKGFGHKPGLKKHPAAPPGGRPFTCATCGKSFQLQVSLSAHQRSCGAPDGSGPGTGGGGSGSGGGGGGSGGGSARDGSALRCGECGRCFTRPAHLIRHRMLHTGERPFPCTECEKRFTERSKLIDHYRTHTGVRPFTCTVCGKSFIRKDHLRKHQRNHAAGAKTPARGQPLPTPPAPPDPFKSPASKGPLASTDLVTDWTCGLSVLGPTDGGDM irs3_ppargc1a_human_dna IRS3 region of PPARGC1A gene ss dna single stranded deoxyribonucleic acid ss DNA ss dna chemical synthesis Chemical synthesis (Chemical synthesis) GCCACTTGCTTGTTTTGGAAGGAAAAT zn746-park2 1 18 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O60260:p.Cys431Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain C F Wed May 02 14:47:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys431phe' Tue Jun 30 17:57:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys431Phe' O60260:p.His257Trp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H W Wed May 02 19:45:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his257trp' Tue Jun 30 15:48:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His257Trp' undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Wed Jul 06 15:04:24 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'gln311x' physical association physical association Figs. 2A, 2C, Supp. Fig. 2B zn746-park2-1 3 18 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey n-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 2B zn746-park2-2 6 9 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait physical association physical association Fig. 2D park2-zn746 6 9 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association Fig. 2D zn746-park2-3 5 10 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association Fig. 2E, Supp. Fig. 2A park2-zn746-1 5 10 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey physical association physical association Fig. 2E, Supp. Fig. 2A park2-zn746-3 1 9 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ring finger 1 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range ring finger 2 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range 18 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Supp. Fig. 2C zn746-park2-4 1 18 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined r1-ibr-r2 region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range certain certain sequence position certain physical association physical association Supp. Fig. 2D irs3-znf746 8 19 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role prey prey direct interaction direct interaction irs1-znf746 8 14 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) 18 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp. Fig. 4F irs2-znf746 8 18 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 16 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supp. Fig. 4F znf746-pckcg 7 18 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey association association ZNF746 binds to the promotor region of the gene Supp. Fig. 4J znf746-g6pc 7 17 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait association association ZNF746 binds to the promotor region of the gene Supp. Fig. 4J znf746-prgc2 7 12 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait association association ZNF746 binds to the promotor region of the gene Fig. 5D znf746-prgc2-1 4 15 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey association association Fig. 5E ZNF746 binds to the promotor of the gene. znf746-pckcg-1 2 11 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait association association ZNF746 binds to the promotor region of the gene Supp. Fig. 4K Observed at equal levels in both control and samples from Parkinson Disease patients. znf746-g6pc-1 2 17 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait association association ZNF746 binds to the promotor region of the gene Supp. Fig. 4J Observed at equal levels in both control and samples from Parkinson Disease patients. znf746-prgc2-2 2 18 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey association association ZNF746 binds to the promotor region of the gene Fig. 5D There is enhanced ZNF746 occupancy of endogenous PPARGC1 in PD striatum compared to control