UniProt UniProt http://www.uniprot.org The Hepatitis B e antigen (HBeAg) targets and suppresses activation of the Toll-like receptor signaling pathway. The Hepatitis B e antigen (HBeAg) targets and suppresses activation of the Toll-like receptor signaling pathway. J. Hepatol. (0168-8278) 2011 imex curation Lang T., Lo C., Skinner N., Locarnini S., Visvanathan K., Mansell A. Ashley.Mansell@monash.edu orchard Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fluorescence imaging fluorescence microscopy fluorescence imaging anti tag immunost anti tag immunostaining anti tag immunost Lang T., Lo C., Skinner N., Locarnini S., Visvanathan K., Mansell A. Ashley.Mansell@monash.edu Accepted 2011-APR-08 by ORCHARD J. Hepatol. (0168-8278) 2011 orchard Only protein-protein interactions imex curation The Hepatitis B e antigen (HBeAg) targets and suppresses activation of the Toll-like receptor signaling pathway. The Hepatitis B e antigen (HBeAg) targets and suppresses activation of the Toll-like receptor signaling pathway. J. Hepatol. (0168-8278) 2011 imex curation Lang T., Lo C., Skinner N., Locarnini S., Visvanathan K., Mansell A. Ashley.Mansell@monash.edu orchard Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lang T., Lo C., Skinner N., Locarnini S., Visvanathan K., Mansell A. Ashley.Mansell@monash.edu Accepted 2011-APR-08 by ORCHARD J. Hepatol. (0168-8278) 2011 orchard Only protein-protein interactions imex curation tirap_human Toll/interleukin-1 receptor domain-containing adapter protein MyD88 adapter-like protein Adaptor protein Wyatt TIRAP MAL protein protein human Homo sapiens Human MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPSLSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLSGLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS DIP protein P58753 original sequence version: 119 44A8454D04704540 tcam2_human TIR domain-containing adapter molecule 2 TRIF-related adapter molecule Toll/interleukin-1 receptor domain-containing protein Toll-like receptor adaptor protein 3 Putative NF-kappa-B-activating protein 502 TICAM2 TIRP TIRAP3 TRAM protein protein human Homo sapiens Human MGIGKSKINSCPLSLSWGKRHSVDTSPGYHESDSKKSEDLSLCNVAEHSNTTEGPTGKQEGAQSVEEMFEEEAEEEVFLKFVILHAEDDTDEALRVQNLLQDDFGIKPGIIFAEMPCGRQHLQNLDDAVNGSAWTILLLTENFLRDTWCNFQFYTSLMNSVNRQHKYNSVIPMRPLNNPLPRERTPFALQTINALEEESRGFPTQVERIFQESVYKTQQTIWKETRNMVQRQFIA 2D1171F9B04D9C4C myd88_human Myeloid differentiation primary response protein MyD88 MYD88 protein protein human Homo sapiens Human MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP CEAE3F6B99524333 p0c6i1-pro_0000324727 External core antigen C HBeAg Precore protein p25 protein protein hbvd5 Hepatitis B virus genotype D subtype ayw (isolate Australia/AustKW/1991) SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYRDALESPEHCTPHHTALRHVCLCWGDLMNLATWVGTNLEDQASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDLVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVRQRGRTIRRRTPSPRRRRSQSPRRRRSQSRESQC 20 212 83CB566C72A8A094 p0c6i1_pro-tirap-3 1 6 unspecified role unspecified role neutral component neutral component dsred fluorescent dye fluorescent dye label fluorescent dye c-term range C-terminal range c-term range c-term range C-terminal range c-term range 3 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Fig. 3D p0c6i1_pro-ticam2-3 1 6 unspecified role unspecified role neutral component neutral component dsred fluorescent dye fluorescent dye label fluorescent dye c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Fig. 3B p0c6i1_pro-tirap-4 2 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 3 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig.3D p0c6i1_pro-ticam2-5 2 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig.3B tirap-myd88-1 2 5 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 3E