MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it A model for the topology of active ribosomal RNA genes. A model for the topology of active ribosomal RNA genes. EMBO Rep. (1469-221X) 2011 imex curation Denissov S., Lessard F., Mayer C., Stefanovsky V., van Driel M., Grummt I., Moss T., Stunnenberg HG. Only protein-protein interactions mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Denissov S., Lessard F., Mayer C., Stefanovsky V., van Driel M., Grummt I., Moss T., Stunnenberg HG. EMBO Rep. (1469-221X) 2011 Only protein-protein interactions imex curation rpac2_mouse DNA-directed RNA polymerases I and III subunit RPAC2 Polr1d Rpo1-3 AC19 DNA-directed RNA polymerase I subunit D RNA polymerase I 16 kDa subunit protein protein mouse Mus musculus Mouse MEDDQELERKISGLKTSMAEGERKTALEMVQAAGTDRQCVTFVLHEEDHTLGNCLRYIIMKNPEVEFCGYTTTHPSESKINLRIQTRGALPAVEPFQKGLNELLNVCQHVLVKFEASIKDYKAKKASKKEPTF DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively mint D355055B67C7388B fbrl_mouse rRNA 2'-O-methyltransferase fibrillarin Fbl Nucleolar protein 1 Histone-glutamine methyltransferase U6 snRNA 2'-O-methyltransferase fibrillarin protein protein mouse Mus musculus Mouse MKPGFSPRGGGFGGRGGFGDRGGRGGGRGGRGGFGGGRGGFGGGGRGRGGGGGGFRGRGGGGGRGGGFQSGGNRGRGGGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRPPPKVKN Involved in pre-rRNA processing. Utilizes the methyl donor S-adenosyl-L-methionine to catalyze the site-specific 2'-hydroxyl methylation of ribose moieties in pre-ribosomal RNA. Site specificity is provided by a guide RNA that base pairs with the substrate. Methylation occurs at a characteristic distance from the sequence involved in base pairing with the guide RNA mint homomint 0E22FE7C758089C3 fbl-polr1d 1 fibrillarin 3 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell RNAP I 2 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization homomint mint f3e sf5