MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it NDUFB7 and NDUFA8 are located at the intermembrane surface of complex I. NDUFB7 and NDUFA8 are located at the intermembrane surface of complex I. FEBS Lett. (0014-5793) 2011 Szklarczyk R., Wanschers BF., Nabuurs SB., Nouws J., Nijtmans LG., Huynen MA. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. bn-page blue native page bn-page mudpit multidimensional protein identification technology mudpit Szklarczyk R., Wanschers BF., Nabuurs SB., Nouws J., Nijtmans LG., Huynen MA. FEBS Lett. (0014-5793) 2011 ndua8_human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 NDUFA8 NADH-ubiquinone oxidoreductase 19 kDa subunit Complex I-19kD Complex I-PGIV protein protein human Homo sapiens Human MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK E1647472B69E1149 ndus3_human NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial NDUFS3 NADH-ubiquinone oxidoreductase 30 kDa subunit Complex I-30kD protein protein human Homo sapiens Human MAAAAVARLWWRGILGASALTRGTGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK C058D62779BEF17B C058D62779BEF17B ndufa8-ndufs3 1 NDUFA8 2 mudpit multidimensional protein identification technology mudpit predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level NDUFS3 3 mudpit multidimensional protein identification technology mudpit predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f5 homomint mint The presence of the matrix subunit NDUFS3 and the Cx9C domaincontaining NDUFA8 were examined with 2D BN-PAGE analysis (Figure 5). Upon normal mitochondrial translation NDUFS3 is present in multiple sub-complexes, while the Cx9C domain-containing NDUFA8 is detectable only in the holocomplex (Figure 5A). Consistent with the prediction, six hours after resuming the translation (Figure 5B) NDUFA8 becomes detectable in late stages of assembly, when the complex is embedded in the inner membrane, while NDUFS3 can be detected in partially formed sub-complexes. After 24 hours NDUFA8 becomes detectable in the membrane-bound holocomplex (Figure 5C).