MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it A single immunoglobulin-domain protein required for clustering acetylcholine receptors in C. elegans. A single immunoglobulin-domain protein required for clustering acetylcholine receptors in C. elegans. EMBO J. (0261-4189) 2011 imex curation Rapti G., Richmond J., Bessereau JL. Only protein-protein interactions caeel Caenorhabditis elegans anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Rapti G., Richmond J., Bessereau JL. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation A single immunoglobulin-domain protein required for clustering acetylcholine receptors in C. elegans. A single immunoglobulin-domain protein required for clustering acetylcholine receptors in C. elegans. EMBO J. (0261-4189) 2011 imex curation Rapti G., Richmond J., Bessereau JL. Only protein-protein interactions caeel Caenorhabditis elegans fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Rapti G., Richmond J., Bessereau JL. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation ach2_caeel Acetylcholine receptor subunit beta-type unc-29 unc-29 T08G11.5 Uncoordinated protein 29 protein protein caeel Caenorhabditis elegans MRTNRLSWILVLSVVIFLVIINTINASDDEERLMVDVFRGYNSLIQPVRNSSELPLIVKMALQLVLLINVDEKDQVMHTNVWLTLQWHDFQMKWNPVNYGEIKQIRVSPDKVWLPDIVLFNNADGNYEVSFMCNVVINHKGDMLWVPPAIYKSSCIIDVEFFPFDEQVCTLVFGSWTYNENEIKLEFVQAELVDVSEYSASSIWDVIDVPASLVNKRSRIEFQVRIRRKTLFYTVVLIIPTVLMAFLSMAVFFLPTDSGEKITLTISVLLSIVVFLLLVSKILPPTSSTIPLMAKYLLLTFVLNVITILVTVIIINVYFRGPRTHRMPQWVRVVFLQFLPKLVCMKRPKSASERSAVRSGMAQLPGVGQFTLSPSAHHPLCPSADDRTTTIRNTASNETSAYYPLSTDALRAIDAIEYITEHLKRDEQHKSFRDDWKYVAMIIDRLLLYVFFGITVGGTCGILFSAPHVFQRIDQQEMLDRLKEKYDTASNIP Acetylcholine receptor mint EBE1D5CC40D25EB6 unc17_caeel Vesicular acetylcholine transporter unc-17 unc-17 Uncoordinated protein 17 ZC416.8 protein protein caeel Caenorhabditis elegans MGFNVPVINRDSEILKADAKKWLEQQDNQKKCVLVIVSIALLLDNMLYMVIVPIIPKYLRDIHNYQVTFEGYHNETSQLANGTYLVREVGGRINFLDEELELGWLFASKALLQIFVNPFSGYIIDRVGYEIPMILGLCTMFFSTAIFALGKSYGVLLFARSLQGFGSAFADTSGLAMIADRFTEENERSAALGIALAFISFGCLVAPPFGSVLYSLAGKPVPFLILSFVCLADAIAVFMVINPHRRGTDSHGEKVQGTPMWRLFMDPFIACCSGALIMANVSLAFLEPTITTWMSEMMPDTPGWLVGVIWLPPFFPHVLGVYVTVKMLRAFPHHTWAIAMVGLAMEGIACFAIPYTTSVMQLVIPLSFVCFGIALIDTSLLPMLGHLVDTRHVSVYGSVYAIADISYSLAYAFGPIIAGWIVTNWGFTALNIIIFATNVTYAPVLFLLRKVHSYDTLGAKGDTAEMTQLNSSAPAGGYNGKPEATTAESYQGWEDQQSYQNQAQIPNHAVSFQDSRPQAEFPAGYDPLNPQW mint 5F37A44C305D32BB oig4_caeel Immunoglobulin domain-containing protein oig-4 oig-4 R07G3.9 protein protein caeel Caenorhabditis elegans MSFRLWGRCIFFFCFLLEAIDSRGGRRGGKGKGKSNLQFAQVAEFSLVQTVLSDNRSAQIITGSHFSQTYRLGYKLLIICKARGDPRPTIKWYKEGAEIQPKASIHYYEKPIENDTIWSKLEVDPATMGDQGVYACVANNPHGVMAKNFKAEYTY mint 01EE06255415CA0A oig_4-unc_17 2 unc-29 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level oig-4 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization f3c mint GFP-OIG- 4 was detected in puncta distributed along the ventral and dorsal nerve cords and in the nerve ring where head muscles are innervated (Figure 3C). These puncta were juxtaposed to cholinergic varicosities stained with antibodies against the vesicular ACh transporter UNC-17 and colocalized with L-AChR clusters (Figure 3C). oig_4-unc_29 1 oig-4 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined unc-29 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f8a mint The L-AChR subunit UNC-29 and the LEV-10 protein were co-immunoprecipitated with GFP-OIG-4 from fractionated worm extracts of transgenic mutants but not of wild-type animals using anti-GFP antibodies (Figure 8A and B).