IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Suppression of colon cancer metastasis by Aes through inhibition of Notch signaling. Suppression of colon cancer metastasis by Aes through inhibition of Notch signaling. Cancer Cell (1535-6108) 2011 imex curation Sonoshita M., Aoki M., Fuwa H., Aoki K., Hosogi H., Sakai Y., Hashida H., Takabayashi A., Sasaki M., Robine S., Itoh K., Yoshioka K., Kakizaki F., Kitamura T., Oshima M., Taketo MM. Fig 1C uses a "pan-TLE" antibody which reacts with TLE1+2+3+4 =nbg Apc (Adenomatous polyposis coli) Delta-716 mutant mice were used, which form adenomas in the small intestine. Results from Fig 1C have not been included as a "pan-TLE" antibody has been used which reacts with TLE1+2+3+4 . taketo@mfour.med.kyoto-u.ac.jp jyoti Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sonoshita M., Aoki M., Fuwa H., Aoki K., Hosogi H., Sakai Y., Hashida H., Takabayashi A., Sasaki M., Robine S., Itoh K., Yoshioka K., Kakizaki F., Kitamura T., Oshima M., Taketo MM. Fig 1C uses a "pan-TLE" antibody which reacts with TLE1+2+3+4 =nbg Apc (Adenomatous polyposis coli) Delta-716 mutant mice were used, which form adenomas in the small intestine. Results from Fig 1C have not been included as a "pan-TLE" antibody has been used which reacts with TLE1+2+3+4 . taketo@mfour.med.kyoto-u.ac.jp Accepted 2011-APR-04 by JYOTI Cancer Cell (1535-6108) 2011 jyoti Only protein-protein interactions imex curation Suppression of colon cancer metastasis by Aes through inhibition of Notch signaling. Suppression of colon cancer metastasis by Aes through inhibition of Notch signaling. Cancer Cell (1535-6108) 2011 imex curation Sonoshita M., Aoki M., Fuwa H., Aoki K., Hosogi H., Sakai Y., Hashida H., Takabayashi A., Sasaki M., Robine S., Itoh K., Yoshioka K., Kakizaki F., Kitamura T., Oshima M., Taketo MM. Fig 1C uses a "pan-TLE" antibody which reacts with TLE1+2+3+4 =nbg Apc (Adenomatous polyposis coli) Delta-716 mutant mice were used, which form adenomas in the small intestine. Results from Fig 1C have not been included as a "pan-TLE" antibody has been used which reacts with TLE1+2+3+4 . taketo@mfour.med.kyoto-u.ac.jp jyoti Only protein-protein interactions mouse Mus musculus Mouse fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Sonoshita M., Aoki M., Fuwa H., Aoki K., Hosogi H., Sakai Y., Hashida H., Takabayashi A., Sasaki M., Robine S., Itoh K., Yoshioka K., Kakizaki F., Kitamura T., Oshima M., Taketo MM. Fig 1C uses a "pan-TLE" antibody which reacts with TLE1+2+3+4 =nbg Apc (Adenomatous polyposis coli) Delta-716 mutant mice were used, which form adenomas in the small intestine. Results from Fig 1C have not been included as a "pan-TLE" antibody has been used which reacts with TLE1+2+3+4 . taketo@mfour.med.kyoto-u.ac.jp Accepted 2011-APR-04 by JYOTI Cancer Cell (1535-6108) 2011 jyoti Only protein-protein interactions imex curation hdac3_human Histone deacetylase 3 HDAC3 RPD3-2 SMAP45 protein protein human Homo sapiens Human MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI DIP protein O15379 original sequence version: 159 DIP protein O15379 original sequence version: 161 DIP protein O15379 original sequence version: 162 DIP protein O15379 original sequence version: 89 DIP protein O15379 original sequence version: 156 DIP protein O15379 original sequence version: 176 DIP protein O15379 original sequence version: 170 DIP protein O15379-1 original sequence version: 170 DIP protein O15379 original sequence version: 127 DIP protein O15379-1 original sequence version: 128 DIP protein O15379 original sequence version: 119 94485C1EBDCF5AD0 tle5_human TLE family member 5 TLE5 AES Amino-terminal enhancer of split GRG GRG5 Gp130-associated protein GAM Grg-5 Groucho-related protein 5 Protein ESP1 Protein GRG TLE family member 5, transcriptional modulator protein protein human Homo sapiens Human MMFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQQLQAHQLSQLQALALPLTPLPVGLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDKNGHDGDTHQEDDGEKSD 3851663AA6921A9F tle5_mouse TLE family member 5 Tle5 Aes Amino-terminal enhancer of split Esp1 Grg Grg-5 Grg5 Groucho-related protein 5 Protein ESP1 Protein GRG protein protein mouse Mus musculus Mouse MMFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQQLQAHQLSQLQALALPLTPLPVGLQPPSLPAVSAGTGLLSLSALGSQTHLSKEDKNGHDGDTHQEDDGEKSD 2C00233AA6921A9F tle1_human Transducin-like enhancer protein 1 TLE1 Enhancer of split groucho-like protein 1 E(Sp1) homolog protein protein human Homo sapiens Human MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNTICAQVIPFLSQEHQQQVAQAVERAKQVTMAELNAIIGQQQLQAQHLSHGHGPPVPLTPHPSGLQPPGIPPLGGSAGLLALSSALSGQSHLAIKDDKKHHDAEHHRDREPGTSNSLLVPDSLRGTDKRRNGPEFSNDIKKRKVDDKDSSHYDSDGDKSDDNLVVDVSNEDPSSPRASPAHSPRENGIDKNRLLKKDASSSPASTASSASSTSLKSKEMSLHEKASTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPPAIDPLVNQAAAGLRTPLAVPGPYPAPFGMVPHAGMNGELTSPGAAYASLHNMSPQMSAAAAAAAVVAYGRSPMVGFDPPPHMRVPTIPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY DIP protein Q04724 original sequence version: 119 695FD1A37410EFE5 hdac3-aes-1 1 3 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region au1 tag au1 tag DTYRYI epitope tag DTYRYI epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig S4B. aes-hdac3 2 3 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig S4A.