I2D I2D Inhibition of androgen receptor activity by histone deacetylase 4 through receptor SUMOylation. Inhibition of androgen receptor activity by histone deacetylase 4 through receptor SUMOylation. Oncogene (0950-9232) 2011 imex curation Yang Y., Tse AK., Li P., Ma Q., Xiang S., Nicosia SV., Seto E., Zhang X., Bai W. Cancer - Interactions investigated in the context of cancer wbai@health.usf.edu 26-Jun-2011: Contacted by JYOTI. jyoti Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yang Y., Tse AK., Li P., Ma Q., Xiang S., Nicosia SV., Seto E., Zhang X., Bai W. Cancer - Interactions investigated in the context of cancer wbai@health.usf.edu Accepted 2011-JUN-02 by JYOTI 26-Jun-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 jyoti Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Inhibition of androgen receptor activity by histone deacetylase 4 through receptor SUMOylation. Inhibition of androgen receptor activity by histone deacetylase 4 through receptor SUMOylation. Oncogene (0950-9232) 2011 imex curation Yang Y., Tse AK., Li P., Ma Q., Xiang S., Nicosia SV., Seto E., Zhang X., Bai W. Cancer - Interactions investigated in the context of cancer wbai@health.usf.edu 26-Jun-2011: Contacted by JYOTI. jyoti Only protein-protein interactions Curated by: I2D - Interologous Interaction Database in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yang Y., Tse AK., Li P., Ma Q., Xiang S., Nicosia SV., Seto E., Zhang X., Bai W. Cancer - Interactions investigated in the context of cancer wbai@health.usf.edu Accepted 2011-JUN-02 by JYOTI 26-Jun-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 jyoti Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Inhibition of androgen receptor activity by histone deacetylase 4 through receptor SUMOylation. Inhibition of androgen receptor activity by histone deacetylase 4 through receptor SUMOylation. Oncogene (0950-9232) 2011 imex curation Yang Y., Tse AK., Li P., Ma Q., Xiang S., Nicosia SV., Seto E., Zhang X., Bai W. Cancer - Interactions investigated in the context of cancer wbai@health.usf.edu 26-Jun-2011: Contacted by JYOTI. jyoti Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yang Y., Tse AK., Li P., Ma Q., Xiang S., Nicosia SV., Seto E., Zhang X., Bai W. Cancer - Interactions investigated in the context of cancer wbai@health.usf.edu Accepted 2011-JUN-02 by JYOTI 26-Jun-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 jyoti Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Inhibition of androgen receptor activity by histone deacetylase 4 through receptor SUMOylation. Inhibition of androgen receptor activity by histone deacetylase 4 through receptor SUMOylation. Oncogene (0950-9232) 2011 imex curation Yang Y., Tse AK., Li P., Ma Q., Xiang S., Nicosia SV., Seto E., Zhang X., Bai W. Cancer - Interactions investigated in the context of cancer wbai@health.usf.edu 26-Jun-2011: Contacted by JYOTI. jyoti Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yang Y., Tse AK., Li P., Ma Q., Xiang S., Nicosia SV., Seto E., Zhang X., Bai W. Cancer - Interactions investigated in the context of cancer wbai@health.usf.edu Accepted 2011-JUN-02 by JYOTI 26-Jun-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 jyoti Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Inhibition of androgen receptor activity by histone deacetylase 4 through receptor SUMOylation. Inhibition of androgen receptor activity by histone deacetylase 4 through receptor SUMOylation. Oncogene (0950-9232) 2011 imex curation Yang Y., Tse AK., Li P., Ma Q., Xiang S., Nicosia SV., Seto E., Zhang X., Bai W. Cancer - Interactions investigated in the context of cancer wbai@health.usf.edu 26-Jun-2011: Contacted by JYOTI. jyoti Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Yang Y., Tse AK., Li P., Ma Q., Xiang S., Nicosia SV., Seto E., Zhang X., Bai W. Cancer - Interactions investigated in the context of cancer wbai@health.usf.edu Accepted 2011-JUN-02 by JYOTI 26-Jun-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 jyoti Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Inhibition of androgen receptor activity by histone deacetylase 4 through receptor SUMOylation. Inhibition of androgen receptor activity by histone deacetylase 4 through receptor SUMOylation. Oncogene (0950-9232) 2011 imex curation Yang Y., Tse AK., Li P., Ma Q., Xiang S., Nicosia SV., Seto E., Zhang X., Bai W. Cancer - Interactions investigated in the context of cancer wbai@health.usf.edu 26-Jun-2011: Contacted by JYOTI. jyoti Only protein-protein interactions Curated by: I2D - Interologous Interaction Database in vitro In vitro enzymatic study enzymatic study western blot western blot Immuno blot Immuno blot Yang Y., Tse AK., Li P., Ma Q., Xiang S., Nicosia SV., Seto E., Zhang X., Bai W. Cancer - Interactions investigated in the context of cancer wbai@health.usf.edu Accepted 2011-JUN-02 by JYOTI 26-Jun-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 jyoti Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database andr_human Androgen receptor Dihydrotestosterone receptor Nuclear receptor subfamily 3 group C member 4 AR DHTR NR3C4 protein protein human Homo sapiens Human MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQQQQQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQSALECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSADLKDILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTSSKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQSRDYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAAGPGSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGEAGAVAPYGYTRPPQGLAGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRLETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ DIP protein P10275 original sequence version: 220 DIP protein P10275-1 original sequence version: 213 DIP protein P10275 original sequence version: 216 DIP protein P10275 original sequence version: 143 DIP protein P10275 original sequence version: 174 DIP protein P10275 original sequence version: 169 DIP protein P10275 original sequence version: 188 DIP protein P10275-1 original sequence version: 188 DIP protein P10275 original sequence version: 196 DIP protein P10275 original sequence version: 217 DIP protein P10275-1 original sequence version: 217 DIP protein P10275-1 original sequence version: 207 A73432C55D39AE06 hdac4_human Histone deacetylase 4 HDAC4 KIAA0288 protein protein human Homo sapiens Human MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLPVAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLAMKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSTSYNHPVLGMYDAKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSGPSSPNNSSGSVSAENGIAPAVPSIPAETSLAHRLVAREGSAAPLPLYTSPSLPNITLGLPATGPSAGTAGQQDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLLEQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHLVIQQQHQQFLEKHKQQFQQQQLQMNKIIPKPSEPARQPESHPEETEEELREHQALLDEPYLDRLPGQKEAHAQAGVQVKQEPIESDEEEAEPPREVEPGQRQPSEQELLFRQQALLLEQQRIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPVSVQEPPTKPRFTTGLVYDTLMLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHTLLYGTNPLNRQKLDSKKLLGSLASVFVRLPCGGVGVDSDTIWNEVHSAGAARLAVGCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLSVSKILIVDWDVHHGNGTQQAFYSDPSVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDPPMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSARCFGYLTKQLMGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVRSMEKVMEIHSKYWRCLQRTTSTAGRSLIEAQTCENEEAETVTAMASLSVGVKPAEKRPDEEPMEEEPPL DIP protein P56524 original sequence version: 158 DIP protein P56524 original sequence version: 149 DIP protein P56524 original sequence version: 151 BB7FD37652D12398 sumo1_human Small ubiquitin-related modifier 1 SUMO1 Sentrin Ubiquitin-like protein SMT3C Ubiquitin-homology domain protein PIC1 Ubiquitin-like protein UBL1 GAP-modifying protein 1 SMT3 homolog 3 SMT3C SMT3H3 UBL1 OK/SW-cl.43 protein protein human Homo sapiens Human MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV DIP protein P63165 original sequence version: 36 DIP protein P63165 original sequence version: 40 DIP protein P63165 original sequence version: 124 DIP protein P63165 original sequence version: 125 DIP protein P63165 original sequence version: 83 DIP protein P63165 original sequence version: 85 DIP protein P63165 original sequence version: 81 DIP protein P63165 original sequence version: 84 DIP protein P63165 original sequence version: 103 DIP protein P63165 original sequence version: 100 DIP protein P63165 original sequence version: 95 DIP protein P63165 original sequence version: 98 DIP protein P63165 original sequence version: 101 DIP protein P63165-1 original sequence version: 131 DIP protein P63165 original sequence version: 102 DIP protein P63165 original sequence version: 122 DIP protein P63165 original sequence version: 62 DIP protein P63165 original sequence version: 119 DIP protein P63165 original sequence version: 82 89BE97D2D054FB33 ar-hdac4 5 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3a Binding of HDAC4 to AR is increased in the presence of 10nm methyltrienolone (R1881). hdac4-ar 5 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey physical association physical association 3a Binding of HDAC4 to AR is increased in the presence of 10nm methyltrienolone (R1881). hdac4-ar-1 2 7 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated in vitro In vitro 8 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction 3b In vitro direct binding of HDAC4 to AR is independent of R1881. hdac4-ar-2 3 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 3c Binding of HDAC4 to AR increased in the presence of 10nm methyltrienolone (R1881). sumo1-ar-1 4 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 5a Cells were treated with 10nM R1881 for 24 hrs. increasing amounts of Flag-HDAC4 enhance ectopic AR conjugation with endogenous SUMO1. ar-sumo1 5 9 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait P10275:p.[Lys388Arg;Lys521Arg] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R Fri Jul 22 11:15:23 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'lys386arg,lys520arg' Wed May 02 16:27:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys388arg,lys521arg' Tue Jun 30 17:26:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys388Arg;Lys521Arg]' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5b AR sumoylation is enhanced by co-transfection of Flag-HDAC4. Cells were treated with 10nM R1881 for 24hr Author confirms that Flag-AR and HA-SUMO1 were both of human origin. sumo1-ar-2 2 7 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5c Co-transfection of Flag-HDAC4 increases the sumoylation of AR. Sumoylation of AR increases with the addition of 10ng R1881 Author confirms that Flag-AR and His-SUMO1 are both of human origin. sumo1-ar-3 6 9 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated P10275:p.[Lys388Arg;Lys521Arg] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R Fri Jul 22 11:11:31 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'lys386arg,lys520arg' Wed May 02 18:26:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys388arg,lys521arg' Tue Jun 30 16:49:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys388Arg;Lys521Arg]' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro sumoylation sumoylation reaction sumoylation 5d Sumoylation of AR increases in the presence of HDAC4 sumo1-ar-4 1 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 6a AR sumoylation is enhanced by co-transfection of increasing amounts of Flag-HDAC4. Cells were treated with 10nM R1881 sumo1-ar-5 3 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 7a, b, f Cells were treated with 10nM R1881 AR sumoylation is enhanced by co-transfection of Flag-HDAC4 in a dose-dependent manner. ar-sumo1-1 3 7 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 7a Cells were treated with 10nM R1881