MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Asf1b, the necessary Asf1 isoform for proliferation, is predictive of outcome in breast cancer. Asf1b, the necessary Asf1 isoform for proliferation, is predictive of outcome in breast cancer. EMBO J. (0261-4189) 2011 imex curation Corpet A., De Koning L., Toedling J., Savignoni A., Berger F., Lemaître C., O'Sullivan RJ., Karlseder J., Barillot E., Asselain B., Sastre-Garau X., Almouzni G. Only protein-protein interactions human-hs487t Homo sapiens hs487t hs487t fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Corpet A., De Koning L., Toedling J., Savignoni A., Berger F., Lemaître C., O'Sullivan RJ., Karlseder J., Barillot E., Asselain B., Sastre-Garau X., Almouzni G. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation Asf1b, the necessary Asf1 isoform for proliferation, is predictive of outcome in breast cancer. Asf1b, the necessary Asf1 isoform for proliferation, is predictive of outcome in breast cancer. EMBO J. (0261-4189) 2011 imex curation Corpet A., De Koning L., Toedling J., Savignoni A., Berger F., Lemaître C., O'Sullivan RJ., Karlseder J., Barillot E., Asselain B., Sastre-Garau X., Almouzni G. Only protein-protein interactions human-hs487bst Homo sapiens hs487bst hs487bst fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Corpet A., De Koning L., Toedling J., Savignoni A., Berger F., Lemaître C., O'Sullivan RJ., Karlseder J., Barillot E., Asselain B., Sastre-Garau X., Almouzni G. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation asf1b_human Histone chaperone ASF1B Anti-silencing function protein 1 homolog B CCG1-interacting factor A-II ASF1B protein protein human Homo sapiens Human MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI DIP protein Q9NVP2 original sequence version: 120 DIP protein Q9NVP2 original sequence version: 98 This sequence has been withdrawn from Uniprot. BD62F726610E3A70 caf1a_human Chromatin assembly factor 1 subunit A CHAF1A CAF CAF1P150 Chromatin assembly factor I p150 subunit protein protein human Homo sapiens Human MLEELECGAPGARGAATAMDCKDRPAFPVKKLIQARLPFKRLNLVPKGKADDMSDDQGTSVQSKSPDLEASLDTLENNCHVGSDIDFRPKLVNGKGPLDNFLRNRIETSIGQSTVIIDLTEDSNEQPDSLVDHNKLNSEASPSREAINGQREDTGDQQGLLKAIQNDKLAFPGETLSDIPCKTEEEGVGCGGAGRRGDSQECSPRSCPELTSGPRMCPRKEQDSWSEAGGILFKGKVPMVVLQDILAVRPPQIKSLPATPQGKNMTPESEVLESFPEEDSVLSHSSLSSPSSTSSPEGPPAPPKQHSSTSPFPTSTPLRRITKKFVKGSTEKNKLRLQRDQERLGKQLKLRAEREEKEKLKEEAKRAKEEAKKKKEEEKELKEKERREKREKDEKEKAEKQRLKEERRKERQEALEAKLEEKRKKEEEKRLREEEKRIKAEKAEITRFFQKPKTPQAPKTLAGSCGKFAPFEIKEHMVLAPRRRTAFHPDLCSQLDQLLQQQSGEFSFLKDLKGRQPLRSGPTHVSTRNADIFNSDVVIVERGKGDGVPERRKFGRMKLLQFCENHRPAYWGTWNKKTALIRARDPWAQDTKLLDYEVDSDEEWEEEEPGESLSHSEGDDDDDMGEDEDEDDGFFVPHGYLSEDEGVTEECADPENHKVRQKLKAKEWDEFLAKGKRFRVLQPVKIGCVWAADRDCAGDDLKVLQQFAACFLETLPAQEEQTPKASKRERRDEQILAQLLPLLHGNVNGSKVIIREFQEHCRRGLLSNHTGSPRSPSTTYLHTPTPSEDAAIPSKSRLKRLISENSVYEKRPDFRMCWYVHPQVLQSFQQEHLPVPCQWSYVTSVPSAPKEDSGSVPSTGPSQGTPISLKRKSAGSMCITQFMKKRRHDGQIGAEDMDGFQADTEEEEEEEGDCMIVDVPDAAEVQAPCGAASGAGGGVGVDTGKATLTASPLGAS DIP protein Q13111 original sequence version: 98 DIP protein Q13111 original sequence version: 147 DIP protein Q13111 original sequence version: 122 90617F8FE8DB7FD0 asf1b-chaf1a 1 ASF1B 3 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell CAF1 p150 4 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization f2d homomint mint A closer analysis by immunofluorescence microscopy revealed that, in individual cells, Asf1b staining perfectly matched CAF-1 p150 staining, while in contrast, Asf1a did not (Figure 2D and E). We thus conclude that Asf1b expression directly correlates with the proliferative status of mammary cells and is overexpressed in highly proliferative tumoral cells. asf1b-chaf1a-1 2 CAF1 p150 4 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell ASF1B 3 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization f2d homomint mint A closer analysis by immunofluorescence microscopy revealed that, in individual cells, Asf1b staining perfectly matched CAF-1 p150 staining, while in contrast, Asf1a did not (Figure 2D and E). We thus conclude that Asf1b expression directly correlates with the proliferative status of mammary cells and is overexpressed in highly proliferative tumoral cells.