MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Yox1 links MBF-dependent transcription to completion of DNA synthesis. Yox1 links MBF-dependent transcription to completion of DNA synthesis. EMBO Rep. (1469-221X) 2011 imex curation Gómez-Escoda B., Ivanova T., Calvo IA., Alves-Rodrigues I., Hidalgo E., Ayté J. Only protein-protein interactions schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Gómez-Escoda B., Ivanova T., Calvo IA., Alves-Rodrigues I., Hidalgo E., Ayté J. EMBO Rep. (1469-221X) 2011 Only protein-protein interactions imex curation Yox1 links MBF-dependent transcription to completion of DNA synthesis. Yox1 links MBF-dependent transcription to completion of DNA synthesis. EMBO Rep. (1469-221X) 2011 imex curation Gómez-Escoda B., Ivanova T., Calvo IA., Alves-Rodrigues I., Hidalgo E., Ayté J. Only protein-protein interactions in vitro In vitro pull down pull down ms participant Identification by mass spectrometry ms participant Gómez-Escoda B., Ivanova T., Calvo IA., Alves-Rodrigues I., Hidalgo E., Ayté J. EMBO Rep. (1469-221X) 2011 Only protein-protein interactions imex curation res1_schpo Cell division cycle-related protein res1/sct1 res1 sct1 SPBC725.16 p72sct1 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MYNDQIHKITYSGVEVFEYTINGFPLMKRCHDNWLNATQILKIAELDKPRRTRILEKFAQKGLHEKIQGGCGKYQGTWVPSERAVELAHEYNVFDLIQPLIEYSGSAFMPMSTFTPQSNRKPTEAYRRNSPVKKSFSRPSHSLLYPYTSSNNMTSTSRMSGIHDALSLQSDFTRSPDMPSDSFTGSLHDIKASPFSSNNYAQSLLDYFLLPNTTQPPDFVYDRPSDWDVNAGIDEDGHTALHWAAAMGNLEMMHALLQAGANVVAVNYLQQTSLMRCVMFTMNYDLQTFEVVSELLQSAICMNDSFGQTVFHHIALLASSKSKMEAARYYMDILLQNLTATQSVDVAAQIINLQDDHGDTALLICARNGAKKCARLLLSFYASSSIPNNQGQYPTDFLSSKDMSFPENDDSPLNSKIEDNLIDNLKYPQSLDDHLSSKKPISYFSNKLTHQTLPNVFTQLSELSKCHEASLAEKQLTYNLAMEALEQTVRETETCQRLWNERTNNDENYLVNQREDLIHQCKKFLHTLKTARYYLETVQLHQLKKYVTYFSQIWSTDELADISETKNLVGHDTKTNRSSLSSKHEVDLFTAENEAAREKLVEQLCSLQAQRKQKINEILNLLSMGMYNTINTDQSGS 91FAEBC78E777A04 cdc10_schpo Start control protein cdc10 cdc10 SPBC336.12c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MASANFIRQFELGNDSFSYQKRPEDEPSQPLSNRNINKLNDSSTLKDSSSRIFINSQVLRDGRPVELYAVECSGMKYMELSCGDNVALRRCPDSYFNISQILRLAGTSSSENAKELDDIIESGDYENVDSKHPQIDGVWVPYDRAISIAKRYGVYEILQPLISFNLDLFPKFSKQQQIESSSISKNLNTSSFNTRSPLRNHNFSNPSKSSKNGVHTINNMQSSPSPSSSFLLPLTQIDSQNVKRSNNYLSTSPPILEQRLKRHRIDVSDEDLHPSSQLNDNEASSLFPDTPRLNHSLSFVSLVSSLPPLDQNIMQDYHTSKDILTSIFLDVNFADSSALEAKLSDSLDLDVPIDELGHAALHWAAAVAKMPLLQALIHKGANPLRGNLTGETALMRSVLVTNHLNQNSFGDLLDLLYASLPCTDRAGRTVVHHICLTAGIKGRGSASRYYLETLLNWAKKHASGNNGYMLKDFINYLNHQDKNGDTALNIAARIGNKNIVEVLMQAGASAYIPNRAGLSVANFGIFVENALKQPEDSKQTKVSLMSENLSSKEKTAVPPRQKSRDIIASVTDVISSLDKDFQDEMAAKQSMIDSAYTQLRESTKKLSDLREQLHVSETQRTLFLELRQRCKNLMTSIEEQKSELSNLYESFDPNGIHDSLSLDADAPFTVNENNNKNLSIAELKFQVAAYERNEARLNELANKLWQRNSNIKSKCRRVVSLCTGVDESRVDSLLESLLQAVESDGQQGEVDMGRVAGFLRVVKEHQA 0E514EE1BE218EFA 0E514EE1BE218EFA yox1_schpo MBF complex negative regulatory component yox1 yox1 SPBC21B10.13c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSLSDSPSKSGNTGKDLISNNEAKNHEDEETHQKKRRRRTTDAEATLLEQYFLKTPKPSLIERQELSKKLKSSMTPRELQIWFQNKRQSLRRSNCLSRNRLEGTGENSLLRRKSTLTLCETSTGQAELFFQSWPLHSQSVVGEMIHHEQDDYNKENKQQKVVDTTKDISRGSNGNEDSAAHQELEECARSLVELQQQCNDH mint A817F550A88F2872 res2_schpo Cell division cycle-related protein res2/pct1 res2 pct1 SPAC22F3.09c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MAPRSSAVHVAVYSGVEVYECFIKGVSVMRRRRDSWLNATQILKVADFDKPQRTRVLERQVQIGAHEKVQGGYGKYQGTWVPFQRGVDLATKYKVDGIMSPILSLDIDEGKAIAPKKKQTKQKKPSVRGRRGRKPSSLSSSTLHSVNEKQPNSSISPTIESSMNKVNLPGAEEQVSATPLPASPNALLSPNDNTIKPVEELGMLEAPLDKYEESLLDFFLHPEEGRIPSFLYSPPPDFQVNSVIDDDGHTSLHWACSMGHIEMIKLLLRANADIGVCNRLSQTPLMRSVIFTNNYDCQTFGQVLELLQSTIYAVDTNGQSIFHHIVQSTSTPSKVAAAKYYLDCILEKLISIQPFENVVRLVNLQDSNGDTSLLIAARNGAMDCVNSLLSYNANPSIPNRQRRTASEYLLEADKKPHSLLQSNSNASHSAFSFSGISPAIISPSCSSHAFVKAIPSISSKFSQLAEEYESQLREKEEDLIRANRLKQDTLNEISRTYQELTFLQKNNPTYSQSMENLIREAQETYQQLSKRLLIWLEARQIFDLERSLKPHTSLSISFPSDFLKKEDGLSLNNDFKKPACNNVTNSDEYEQLINKLTSLQASRKKDTLYIRKLYEELGIDDTVNSYRRLIAMSCGINPEDLSLEILDAVEEALTREK 1159312B63E475E4 1159312B63E475E4 cdc10-res2-2 1 Res2 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level YOX1 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P40923:p.Ser114Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:51:41 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 16:10:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser114ala' Tue Jun 30 18:08:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser114Ala' P40923:p.Thr115Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain T A Tue Jul 12 10:10:37 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 18:25:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr115ala' Tue Jun 30 15:48:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr115Ala' cdc10 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association f2a mint when Yox1 was phosphorylated as a consequence of the activation of the DNA synthesis checkpoint after hydroxyurea treatment, this interaction was lost (Fig 2A, lanes 5 and 6; Fig 2B). Nevertheless, this interaction was preserved in cells in which this Cds1-dependent phosphorylation was abrogated, because they expressed a mutant Yox1 that cannot be phosphorylated (Yox1.SATA; Fig 2A, lanes 7 and 8). yox1-cdc10 1 YOX1 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cdc10 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint f2b sf1c cdc10-yox1 1 YOX1 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cdc10 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association sf1c mint cdc10-res1 2 res2 6 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level res1 3 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level YOX1 5 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level cdc10 4 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association mint sf1a sf1b