MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Molecular mechanism by which the nucleoid occlusion factor, SlmA, keeps cytokinesis in check. Molecular mechanism by which the nucleoid occlusion factor, SlmA, keeps cytokinesis in check. EMBO J. (0261-4189) 2011 imex curation Tonthat NK., Arold ST., Pickering BF., Van Dyke MW., Liang S., Lu Y., Beuria TK., Margolin W., Schumacher MA. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Tonthat NK., Arold ST., Pickering BF., Van Dyke MW., Liang S., Lu Y., Beuria TK., Margolin W., Schumacher MA. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation Molecular mechanism by which the nucleoid occlusion factor, SlmA, keeps cytokinesis in check. Molecular mechanism by which the nucleoid occlusion factor, SlmA, keeps cytokinesis in check. EMBO J. (0261-4189) 2011 imex curation Tonthat NK., Arold ST., Pickering BF., Van Dyke MW., Liang S., Lu Y., Beuria TK., Margolin W., Schumacher MA. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Tonthat NK., Arold ST., Pickering BF., Van Dyke MW., Liang S., Lu Y., Beuria TK., Margolin W., Schumacher MA. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation Molecular mechanism by which the nucleoid occlusion factor, SlmA, keeps cytokinesis in check. Molecular mechanism by which the nucleoid occlusion factor, SlmA, keeps cytokinesis in check. EMBO J. (0261-4189) 2011 imex curation Tonthat NK., Arold ST., Pickering BF., Van Dyke MW., Liang S., Lu Y., Beuria TK., Margolin W., Schumacher MA. Only protein-protein interactions in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Tonthat NK., Arold ST., Pickering BF., Van Dyke MW., Liang S., Lu Y., Beuria TK., Margolin W., Schumacher MA. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation slma_ecoli Nucleoid occlusion factor SlmA Protein Ttk slmA ttk yicB Synthetically lethal with a defective Min system protein A b3641 JW5641 protein protein ecoli Escherichia coli (strain K12) MAEKQTAKRNRREEILQSLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGERNPGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDETLLASQILAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ mint C797B0E2875B0E39 ftsz_ecoli Cell division protein FtsZ ftsZ sfiB sulB b0095 JW0093 protein protein ecoli Escherichia coli (strain K12) MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTDAQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGMGGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITIPNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNTIRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQQHGMAPLTQEQKPVAKVVNDNAPQTAKEPDYLDIPAFLRKQAD DIP protein P0A9A6 original sequence version: 83 DIP protein P0A9A6 original sequence version: 82 DIP protein P0A9A6 original sequence version: 72 B3A53340367DBBA0 slma-1 1 slmA 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction mint Coordinates and structure factor amplitudes for the SlmA structure have been deposited with the Protein Data Bank under the accession code 3NXC. f1a f1b f1d st1 sf1a sf3 slma-1 2 slmA 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction f1c mint ftsz-slma 3 slmA 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ftsZ 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction mint sf9c