MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The structure of an Iws1/Spt6 complex reveals an interaction domain conserved in TFIIS, Elongin A and Med26. The structure of an Iws1/Spt6 complex reveals an interaction domain conserved in TFIIS, Elongin A and Med26. EMBO J. (0261-4189) 2010 imex curation Diebold ML., Koch M., Loeliger E., Cura V., Winston F., Cavarelli J., Romier C. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Diebold ML., Koch M., Loeliger E., Cura V., Winston F., Cavarelli J., Romier C. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation The structure of an Iws1/Spt6 complex reveals an interaction domain conserved in TFIIS, Elongin A and Med26. The structure of an Iws1/Spt6 complex reveals an interaction domain conserved in TFIIS, Elongin A and Med26. EMBO J. (0261-4189) 2010 imex curation Diebold ML., Koch M., Loeliger E., Cura V., Winston F., Cavarelli J., Romier C. Only protein-protein interactions ecoli Escherichia coli (strain K12) pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Diebold ML., Koch M., Loeliger E., Cura V., Winston F., Cavarelli J., Romier C. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation spt8_yeast Transcription factor SPT8 L2144 YLR055C SPT8 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDEVDDILINNQVVDDEEDDEEMLSGLENDSKQDLEGNDDGGEDEEDDDDDDEDDDDDEDEREDDDEQEDDDGEDDAARMDKTATPTNEHQHDEQKAAAAGAGGAGDSGDAVTKIGSEDVKLSDVDGGVGSREASSSTHEASANGEVYEYYKHMLNAAQIADSYNIYPTAAIPIQTHVNALAVSRGLKYLFLGGSDGYIRKYDLLNTLEGKLSLTILQKHSLAESIQNAGILQSYWENEIPQKKSEMKLSANKTDYEPKVSPVHSLEVQSECLFILSGLQNGGITMQGVRYMEGSIAHYFKGRNGHTQIVNILRLNGQEDRFLSGSWDKRLLEWDLQTGDIVNEFKKSRSELSSLEMRPLYSSVDVSGNVNSGKENENADDDMDSLFGDEDEDEKQDAGNEPVETGDGSNGEENKEQISEESLNIVYDESVFMTSGLNGSVHIWDRRMTQSPALSLERGAGVPPWCLSACWGVDGDHVYAGRRNACVEQFDLKMPSKPIHNLKLPSISGPVSCVKAMPNNKHLLCASRDNIRLYNVEIAVDASNSTTKSSKVPFLIVPGHHGGIISNLYLDPTSRFIISTSGNRGWQGNSTDTTLIYDIDLE DDE88155E7638B46 DDE88155E7638B46 iws1_yeast Transcription factor SPN1 SPN1 Interacts with SPT6 protein 1 Suppresses postrecruitment functions protein 1 IWS1 YPR133C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTADQEQPKVVEATPEDGTASSQKSTINAENENTKQNQSMEPQETSKGTSNDTKDPDNGEKNEEAAIDENSNVEAAERKRKHISTDFSDDDLEKEEHNDQSLQPTVENRASKDRDSSATPSSRQELEEKLDRILKKPKVRRTRRDEDDLEQYLDEKILRLKDEMNIAAQLDIDTLNKRIETGDTSLIAMQKVKLLPKVVSVLSKANLADTILDNNLLQSVRIWLEPLPDGSLPSFEIQKSLFAALNDLPVKTEHLKESGLGRVVIFYTKSKRVEAQLARLAEKLIAEWTRPIIGASDNYRDKRIMQLEFDSEKLRKKSVMDSAKNRKKKSKSGEDPTSRGSSVQTLYEQAAARRNRAAAPAQTTTDYKYAPVSNLSAVPTNARAVGVGSTLNNSEMYKRLTSRLNKKHK 7BC925FC8BA80E65 7BC925FC8BA80E65 q8sus7_enccu TFIIS N-terminal domain-containing protein ECU08_0440 protein protein enccu Encephalitozoon cuniculi (strain GB-M1) Microsporidian parasite MDRDSGQDFPEAQSGEFGDTGGRQKKAKAASRAERKGDLDPGTVLEISRSLKKRMQDILKKDNANNLEGRPATGKIENVEEISDILMSKALQESLLDEGILDEIKGWLEPLPDKSMPNIKIRKRLLDVLKTMKIHKEHLVTSGVGKIVYFYSINPKESKEVRASAKALVQKWTNEVFKPEGGD mint 2BF76A61AD80496B q8srg7_enccu ECU07_1690 protein protein enccu Encephalitozoon cuniculi (strain GB-M1) Microsporidian parasite MGDSSSEEVINISRREHQVARKRVLEDLFEEDEREISEESISSIDYGDRDSLFFEIFGTGEEYRYVLESDPHEVAEEAGRCDEPTPESKTVDLDKVYEYAANNMRTRTESLKKIIELVGRGYTIHFALLHSGIEDVGIEEGYEVVDIFDEYREFVDLKEKMRRRYGNDKLLQDIEGIQGLKWYSAYKKHLDKDLSLPDELLSAEDFCENIKAKKKIHEPRNSSFLSDFANEDKLIQRISLHPVFRSALYTVFRNHGIRSEKNGLDVRDDVMKRDLVDFYLSDISSEDPWNRYRERIIRSSAEKAAKEAIVPLVLKETDLREMKRRVFVEAVDRIVNGSIGIKGDGTHVCGVTREKKYLKAVTVNFEGDLVDYITVKEEEKDELLRFIEKFDPCCVAVSGSTTSIRYLMKDLSPWNPVYVESRLAHTKAEDTYSFCCNIARIIQCPEIEYSDMLEKGIVYIQQQILPRNVMVETIRKGILTAISIVGVDVNYLLNNRRKEGLLSLIPTSSSLKSSLSDLRCVMKLEDLKDLCESEVEYDNLVTYIRVHPRVLSRVSGSEILDATPVHPKNYDVVRKLCTDLCNEEGVDEKNLDPVKKALSNAKELLKTSRPKILECGDPLTIDVYKTLVDGDRPIYSGLPDHLVFKELTGCDESLIGKVVEGRISKCGNTYYLLDSNATPAAIYIRKNRGQQELFLNQLVTVRIEYMNDFLLSYTASIAVSEQKKPNHSRFMTHPLFKDLNSEQSEEYLKDHSSSILLRRSRKDCSPVVVLKVSDGIYIHMKIQEAEKYYYKGNSYDDLDEFISRVAKKMLTNFKNIKNHKYYFENEEKLLDYLNQGGSYIRYGFCLSRKYPGKLCMLYRDGRNHKEYITVDEHLVYEGRNFASLDEFVRYRKSL mint ACFB066CEBA7F91A spt6_yeast Transcription elongation factor SPT6 CRE2 SPT6 SSN20 YGR116W G6169 Chromatin elongation factor SPT6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MEETGDSKLVPRDEEEIVNDNDETKAPSEEEEGEDVFDSSEEDEDIDEDEDEARKVQEGFIVNDDDENEDPGTSISKKRRKHKRREREEDDRLSEDDLDLLMENAGVERTKASSSSGKFKRLKRVGDEGNAAESESDNVAASRQDSTSKLEDFFSEDEEEEESGLRNGRNNEYGRDEEDHENRNRTADKGGILDELDDFIEDDEFSDEDDETRQRRIQEKKLLREQSIKQPTQITGLSSDKIDEMYDIFGDGHDYDWALEIENEELENGNDNNEAEEEEIDEETGAIKSTKKKISLQDIYDLEDLKKNLMTEGDMKIRKTDIPERYQELRAGITDYGNMSSEDQELERNWIAEKISVDKNFDANYDLTEFKEAIGNAIKFITKENLEVPFIYAYRRNYISSREKDGFLLTEDDLWDIVSLDIEFHSLVNKKDYVQRFYAELHIDDPIVTEYFKNQNTASIAELNSLQDIYDYLEFKYANEINEMFINHTGKTGKKHLKNSSYEKFKASPLYQAVSDIGISAEDVGENISSQHQIHPPVDHPSSKPVEVIESILNANSGDLQVFTSNTKLAIDTVQKYYSLELSKNTKIREKVRSDFSKYYLADVVLTAKGKKEIQKGSLYEDIKYAINRTPMHFRRDPDVFLKMVEAESLNLLSVKLHMSSQAQYIEHLFQIALETTNTSDIAIEWNNFRKLAFNQAMDKIFQDISQEVKDNLTKNCQKLVAKTVRHKFMTKLDQAPFIPNVRDPKIPKILSLTCGQGRFGADAIIAVYVNRKGDFIRDYKIVDNPFDKTNPEKFEDTLDNIIQSCQPNAIGINGPNPKTQKFYKRLQEVLHKKQIVDSRGHTIPIIYVEDEVAIRYQNSERAAQEFPNKPPLVKYCIALARYMHSPLLEYANLTSEEVRSLSIHPHQNLLSSEQLSWALETAFVDIVNLVSVEVNKATDNNYYASALKYISGFGKRKAIDFLQSLQRLNEPLLARQQLITHNILHKTIFMNSAGFLYISWNEKRQKYEDLEHDQLDSTRIHPEDYHLATKVAADALEYDPDTIAEKEEQGTMSEFIELLREDPDRRAKLESLNLESYAEELEKNTGLRKLNNLNTIVLELLDGFEELRNDFHPLQGDEIFQSLTGESEKTFFKGSIIPVRVERFWHNDIICTTNSEVECVVNAQRHAGAQLRRPANEIYEIGKTYPAKVIYIDYANITAEVSLLDHDVKQQYVPISYSKDPSIWDLKQELEDAEEERKLMMAEARAKRTHRVINHPYYFPFNGRQAEDYLRSKERGEFVIRQSSRGDDHLVITWKLDKDLFQHIDIQELEKENPLALGKVLIVDNQKYNDLDQIIVEYLQNKVRLLNEMTSSEKFKSGTKKDVVKFIEDYSRVNPNKSVYYFSLNHDNPGWFYLMFKINANSKLYTWNVKLTNTGYFLVNYNYPSVIQLCNGFKTLLKSNSSKNRMNNYR 0BE9922A59BD0483 0BE9922A59BD0483 ssn2_yeast Mediator of RNA polymerase II transcription subunit 13 YDR443C SSN2 SCA1 MED13 NUT8 RYE3 SRB9 UME2 Mediator complex subunit 13 Suppressor of RNA polymerase B SSN2 Protein SCA1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSDASTYRLEDVLSSFYRVEKIKKINYHQYISKAQNDQWSIQMEFMLRKQDPKTLVALLSRDLWCFSINDDPVPTPPAIEHKPVSPDKIGTFTADYSKPNLPPHYALFLKALRRKIYINLALGSHNKLIQFGNACISLSGVPNYLVQLEPHLFVNGDLTVSLCAKNMGLVPMKEENLEESFLSKHALYLAPSGIRMHLAPASKQGYLITPPKHTELLLTTLSVSHGINLQNKKNLKWVAVVPDLGHLNGHTPTIASYLTPLLEAKKLVWPLHLIFAQPVADIENSTSGDPSEFHCLQDALDAIDDFIQLKQTAAYRTPGSSGVLSSNIAGTNPLSSDGAYTEQFQHYKNNSISSQPASYHSVQETNKISPKDFSPNFTGIDKLMLSPSDQFAPAFLNTPNNNINENELFNDRKQTTVSNDLENSPLKTELEANGRSLEKVNNSVSKTGSVDTLHNKEGTLEQREQNENLPSDKSDSMVDKELFGEDEDEDLFGDSNKSNSTNESNKSISDEITEDMFEMSDEEENNNNKSINKNNKEMHTDLGKDIPFFPSSEKPNIRTMSGTTKRLNGKRKYLDIPIDEMTLPTSPLYMDPGAPLPVETPRDRRKSVFAPLNFNPIIENNVDNKYKSGGKFSFSPLQKEEALNFDISMADLSSSEEEEDEEENGSSDEDLKSLNVRDDMKPSDNISTNTNIHEPQYINYSSIPSLQDSIIKQENFNSVNDANITSNKEGFNSIWKIPQNDIPQTESPLKTVDSSIQPIESNIKMTLEDNNVTSNPSEFTPNMVNSEISNLPKDKSGIPEFTPADPNLSFESSSSLPFLLRHMPLASIPDIFITPTPVVTISEKEQDILDLIAEQVVTDYNILGNLGIPKIAYRGVKDCQEGLITTTMLQLFSTFDRLNGNDTISKFYNMKQPYVFVKKHHELIKVKHDSQPFIKFLNFRPPNGIKNFKSLLLSSSFKEDCLSFAPTLSQTYINQELGFCELLKLTNEDPPGLMYLKAFDKNKLLLLAAQIVSYCSNNKNSIKNVPPILIILPLDNATLTELVDKANIFQVIKNEVCAKMPNIELYLKVIPMDFIRNVLVTVDQYVNVAISIYNMLPPKSVKFTHIAHTLPEKVNFRTMQQQQMQQQQQQQQQQQNNSTGSSSIIYYDSYIHLAYSRSVDKEWVFAALSDSYGQGSMTKTWYVGNSRGKFDDACNQIWNIALNLASKKFGKICLILTRLNGILPDDELMNWRRLSGRNIHLAVVCVDDNSKISFIDEDKLYPSFKPIYKDTRFGGRMDMTRLYDYEIRDIDQDIHGIVFQHPFPLAHSQHRCAIRSGALIKFKKCDGDTVWDKFAVNLLNCPHSDSTQLLETILEEFRNLAALNVWYGLSDGEDGHIPWHILAVKKMMNTLVHTRVKIANTSAATVHTATSSSIILSDK 7F6CF4BBE0FAC918 tfs2_yeast Transcription elongation factor S-II YGL043W DST1 PPR2 DNA strand transfer protein alpha DNA strand transferase 1 Pyrimidine pathway regulatory protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDSKEVLVHVKNLEKNKSNDAAVLEILHVLDKEFVPTEKLLRETKVGVEVNKFKKSTNVEISKLVKKMISSWKDAINKNKRSRQAQQHHQDHAPGNAEDKTTVGESVNGVQQPASSQSDAMKQDKYVSTKPRNSKNDGVDTAIYHHKLRDQVLKALYDVLAKESEHPPQSILHTAKAIESEMNKVNNCDTNEAAYKARYRIIYSNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEEIAKQNLYNAQGATIERSVTDRFTCGKCKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWKFS D133938319C015FF D133938319C015FF q8srg7-q8sus7 1 Spt6 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Iws1 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction mint f4 st2 The structures described in this project have been deposited under the PDB codes 2xpl, 2xpn, 2xpo and 2xpp. q8srg7-q8sus7-1 2 Spt6 6 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Iws1 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association f1a f1b mint q8srg7-q8sus7-2 2 Iws1 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Spt6 6 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q8SRG7:p.Gly58Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G A Tue Jul 12 10:18:03 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:30:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly58ala' Tue Jun 30 16:56:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly58Ala' Q8SRG7:p.Gly60Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G A Tue Jul 12 10:17:59 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:25:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly60ala' Tue Jun 30 17:12:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly60Ala' binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association f5a mint q8srg7-q8sus7-3 2 Iws1 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Spt6 6 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q8SRG7:p.Tyr65Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Tue Jul 12 10:55:11 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:42:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr65ala' Tue Jun 30 16:31:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr65Ala' his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q8SRG7:p.Tyr63Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Tue Jul 12 10:55:08 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:15:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr63ala' Tue Jun 30 16:23:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr63Ala' physical association physical association f5a mint spt6-spn1 2 Spt6 7 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P23615:p.Ile248Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I A Tue Jul 12 10:15:28 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:58:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile248ala' Tue Jun 30 18:05:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile248Ala' P23615:p.Phe249Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Tue Jul 12 10:15:26 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:55:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe249ala' Tue Jun 30 16:13:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe249Ala' Iws1 4 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association f5b homomint mint spt6-spn1-1 2 Iws1 4 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Spt6 7 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association f1c homomint mint ssn2-dst1 2 MED13 8 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell P38931:p.Leu483Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Tue Jul 12 10:15:42 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:38:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu483ala' Tue Jun 30 17:54:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu483Ala' P38931:p.Phe484Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Tue Jul 12 10:59:02 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:36:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe484ala' Tue Jun 30 17:31:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe484Ala' binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined TFIIS 9 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association f6d mint ssn2-dst1-1 2 MED13 8 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain undefined mutation mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:43:45 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 488-508 TFIIS 9 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association f6d mint spt8-dst1 2 Spt8 3 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:43:39 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 391-402 binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined TFIIS 9 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association f6d mint spt8-dst1-1 2 Spt8 3 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P38915:p.Leu386Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Tue Jul 12 10:58:07 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:24:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu386ala' Tue Jun 30 18:38:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu386Ala' his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P38915:p.Phe387Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Tue Jul 12 10:22:30 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:59:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe387ala' Tue Jun 30 17:16:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe387Ala' TFIIS 9 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association f6d mint q8srg7-q8sus7-4 2 Iws1 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:40:59 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' Lys90Asn Spt6 6 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association sf2b mint q8srg7-q8sus7-5 2 Spt6 6 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Iws1 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain undefined mutation mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:41:09 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' Lys90Asp physical association physical association sf2b mint