MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Direct observation of stepped proteolipid ring rotation in E. coli F₀F₁-ATP synthase. Direct observation of stepped proteolipid ring rotation in E. coli F₀F₁-ATP synthase. EMBO J. (0261-4189) 2010 imex curation Ishmukhametov R., Hornung T., Spetzler D., Frasch WD. Only protein-protein interactions in vitro In vitro biophysical biophysical predetermined predetermined participant predetermined Ishmukhametov R., Hornung T., Spetzler D., Frasch WD. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation atp6_ecoli ATP synthase subunit a atpB papD uncB b3738 JW3716 F-ATPase subunit 6 ATP synthase F0 sector subunit a protein protein ecoli Escherichia coli (strain K12) MASENMTPQDYIGHHLNNLQLDLRTFSLVDPQNPPATFWTINIDSMFFSVVLGLLFLVLFRSVAKKATSGVPGKFQTAIELVIGFVNGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDLLPIDLLPYIAEHVLGLPALRVVPSADVNVTLSMALGVFILILFYSIKMKGIGGFTKELTLQPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVPWAIFHILIITLQAFIFMVLTIVYLSMASEEH DIP protein P0AB98 original sequence version: 49 4933EAF09401566D atpl_ecoli ATP synthase subunit c Lipid-binding protein Dicyclohexylcarbodiimide-binding protein atpE papH uncE b3737 JW3715 ATP synthase F(0) sector subunit c F-type ATPase subunit c protein protein ecoli Escherichia coli (strain K12) MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLVDAIPMIAVGLGLYVMFAVA 0F595A69D8AD1F9E atpb-atpe-2 1 ATP synthase subunit c 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ATP synthase subunit a 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction f4 f5 mint Here, we show the presence of a transient dwell between Fo subunits a and c by improving the time resolution to 10 ls at unprecedented S/N, and by using Escherichia coli FoF1 embedded in lipid bilayer nanodiscs. The data in Figures 4 and 5 indicate that the transient dwells result from a periodic interaction between subunits-a and c in Fo that has not been previously described.