I2D I2D WW domain-mediated interaction with Wbp2 is important for the oncogenic property of TAZ. WW domain-mediated interaction with Wbp2 is important for the oncogenic property of TAZ. Oncogene (0950-9232) 2011 imex curation Chan SW., Lim CJ., Huang C., Chong YF., Gunaratne HJ., Hogue KA., Blackstock WP., Harvey KF., Hong W. Cancer - Interactions investigated in the context of cancer mcbhwj@imcb.a-star.edu.sg 06-Jun-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Chan SW., Lim CJ., Huang C., Chong YF., Gunaratne HJ., Hogue KA., Blackstock WP., Harvey KF., Hong W. Cancer - Interactions investigated in the context of cancer mcbhwj@imcb.a-star.edu.sg Accepted 2011-APR-08 by ORCHARD 06-Jun-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database WW domain-mediated interaction with Wbp2 is important for the oncogenic property of TAZ. WW domain-mediated interaction with Wbp2 is important for the oncogenic property of TAZ. Oncogene (0950-9232) 2011 imex curation Chan SW., Lim CJ., Huang C., Chong YF., Gunaratne HJ., Hogue KA., Blackstock WP., Harvey KF., Hong W. Cancer - Interactions investigated in the context of cancer mcbhwj@imcb.a-star.edu.sg 06-Jun-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Chan SW., Lim CJ., Huang C., Chong YF., Gunaratne HJ., Hogue KA., Blackstock WP., Harvey KF., Hong W. Cancer - Interactions investigated in the context of cancer mcbhwj@imcb.a-star.edu.sg Accepted 2011-APR-08 by ORCHARD 06-Jun-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database WW domain-mediated interaction with Wbp2 is important for the oncogenic property of TAZ. WW domain-mediated interaction with Wbp2 is important for the oncogenic property of TAZ. Oncogene (0950-9232) 2011 imex curation Chan SW., Lim CJ., Huang C., Chong YF., Gunaratne HJ., Hogue KA., Blackstock WP., Harvey KF., Hong W. Cancer - Interactions investigated in the context of cancer mcbhwj@imcb.a-star.edu.sg 06-Jun-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chan SW., Lim CJ., Huang C., Chong YF., Gunaratne HJ., Hogue KA., Blackstock WP., Harvey KF., Hong W. Cancer - Interactions investigated in the context of cancer mcbhwj@imcb.a-star.edu.sg Accepted 2011-APR-08 by ORCHARD 06-Jun-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database WW domain-mediated interaction with Wbp2 is important for the oncogenic property of TAZ. WW domain-mediated interaction with Wbp2 is important for the oncogenic property of TAZ. Oncogene (0950-9232) 2011 imex curation Chan SW., Lim CJ., Huang C., Chong YF., Gunaratne HJ., Hogue KA., Blackstock WP., Harvey KF., Hong W. Cancer - Interactions investigated in the context of cancer mcbhwj@imcb.a-star.edu.sg 06-Jun-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chan SW., Lim CJ., Huang C., Chong YF., Gunaratne HJ., Hogue KA., Blackstock WP., Harvey KF., Hong W. Cancer - Interactions investigated in the context of cancer mcbhwj@imcb.a-star.edu.sg Accepted 2011-APR-08 by ORCHARD 06-Jun-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database WW domain-mediated interaction with Wbp2 is important for the oncogenic property of TAZ. WW domain-mediated interaction with Wbp2 is important for the oncogenic property of TAZ. Oncogene (0950-9232) 2011 imex curation Chan SW., Lim CJ., Huang C., Chong YF., Gunaratne HJ., Hogue KA., Blackstock WP., Harvey KF., Hong W. Cancer - Interactions investigated in the context of cancer mcbhwj@imcb.a-star.edu.sg 06-Jun-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-mcf10a Human non-transformed breast epithelial cell line mcf10a non-transformed human breast epithelial cell line confocal microscopy confocal microscopy immunostaining immunostaining Chan SW., Lim CJ., Huang C., Chong YF., Gunaratne HJ., Hogue KA., Blackstock WP., Harvey KF., Hong W. Cancer - Interactions investigated in the context of cancer mcbhwj@imcb.a-star.edu.sg Accepted 2011-APR-08 by ORCHARD 06-Jun-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database tead4_human Transcriptional enhancer factor TEF-3 TEAD4 RTEF1 TCF13L1 TEF3 TEA domain family member 4 Transcription factor RTEF-1 Transcription factor 13-like 1 protein protein human Homo sapiens Human MEGTAGTITSNEWSSPTSPEGSTASGGSQALDKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE DIP protein Q15561 original sequence version: 131 DIP protein Q15561-1 original sequence version: 138 544DDFD86E88D9A8 cpsf5_human Cleavage and polyadenylation specificity factor subunit 5 NUDT21 CFIM25 CPSF25 CPSF5 Cleavage and polyadenylation specificity factor 25 kDa subunit Nucleoside diphosphate-linked moiety X motif 21 Cleavage factor Im complex 25 kDa subunit Nudix hydrolase 21 Pre-mRNA cleavage factor Im 68 kDa subunit protein protein human Homo sapiens Human MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN DIP protein O43809 original sequence version: 95 D204243E57F1CCC5 wbp2_human WW domain-binding protein 2 WBP2 protein protein human Homo sapiens Human MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEAGGGWEGSASYKLTFTAGGAIEFGQRMLQVASQASRGEVPSGAYGYSYMPSGAYVYPPPVANGMYPCPPGYPYPPPPPEFYPGPPMMDGAMGYVQPPPPPYPGPMEPPVSGPDVPSTPAAEAKAAEAAASAYYNPGNPHNVYMPTSQPPPPPYYPPEDKKTQ DIP protein Q969T9 original sequence version: 112 8043727A03E67C82 ybox1_human Y-box-binding protein 1 YBX1 YB1 NSEP1 Y-box transcription factor CCAAT-binding transcription factor I subunit A Enhancer factor I subunit A DNA-binding protein B Nuclease-sensitive element-binding protein 1 protein protein human Homo sapiens Human MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE DIP protein P67809 original sequence version: 39 DF0114BF974AEDB8 amot_human Angiomotin AMOT KIAA1071 protein protein human Homo sapiens Human MRNSEEQPSGGTTVLQRLLQEQLRYGNPSENRSLLAIHQQATGNGPPFPSGSGNPGPQSDVLSPQDHHQQLVAHAARQEPQGQEIQSENLIMEKQLSPRMQNNEELPTYEEAKVQSQYFRGQQHASVGAAFYVTGVTNQKMRTEGRPSVQRLNPGKMHQDEGLRDLKQGHVRSLSERLMQMSLATSGVKAHPPVTSAPLSPPQPNDLYKNPTSSSEFYKAQGPLPNQHSLKGMEHRGPPPEYPFKGMPPQSVVCKPQEPGHFYSEHRLNQPGRTEGQLMRYQHPPEYGAARPAQDISLPLSARNSQPHSPTSSLTSGGSLPLLQSPPSTRLSPARHPLVPNQGDHSAHLPRPQQHFLPNQAHQGDHYRLSQPGLSQQQQQQQQQHHHHHHHQQQQQQQPQQQPGEAYSAMPRAQPSSASYQPVPADPFAIVSRAQQMVEILSDENRNLRQELEGCYEKVARLQKVETEIQRVSEAYENLVKSSSKREALEKAMRNKLEGEIRRMHDFNRDLRERLETANKQLAEKEYEGSEDTRKTISQLFAKNKESQREKEKLEAELATARSTNEDQRRHIEIRDQALSNAQAKVVKLEEELKKKQVYVDKVEKMQQALVQLQAACEKREQLEHRLRTRLERELESLRIQQRQGNCQPTNVSEYNAAALMELLREKEERILALEADMTKWEQKYLEENVMRHFALDAAATVAAQRDTTVISHSPNTSYDTALEARIQKEEEEILMANKRCLDMEGRIKTLHAQIIEKDAMIKVLQQRSRKEPSKTEQLSCMRPAKSLMSISNAGSGLLSHSSTLTGSPIMEEKRDDKSWKGSLGILLGGDYRAEYVPSTPSPVPPSTPLLSAHSKTGSRDCSTQTERGTESNKTAAVAPISVPAPVAAAATAAAITATAATITTTMVAAAPVAVAAAAAPAAAAAPSPATAAATAAAVSPAAAGQIPAAASVASAAAVAPSAAAAAAVQVAPAAPAPVPAPALVPVPAPAAAQASAPAQTQAPTSAPAVAPTPAPTPTPAVAQAEVPASPATGPGPHRLSIPSLTCNPDKTDGPVFHSNTLERKTPIQILGQEPDAEMVEYLI DIP protein Q4VCS5 original sequence version: 101 D7E7021E9535A628 amol1_human Angiomotin-like protein 1 AMOTL1 protein protein human Homo sapiens Human MWRAKLRRGTCEPAVKGSPSACYSPSSPVQVLEDSTYFSPDFQLYSGRHETSALTVEATSSIREKVVEDPLCNFHSPNFLRISEVEMRGSEDAAAGTVLQRLIQEQLRYGTPTENMNLLAIQHQATGSAGPAHPTNNFSSTENLTQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRSTQPQQNNEELPTYEEAKAQSQFFRGQQQQQQQQGAVGHGYYMAGGTSQKSRTEGRPTVNRANSGQAHKDEALKELKQGHVRSLSERIMQLSLERNGAKQHLPGSGNGKGFKVGGGPSPAQPAGKVLDPRGPPPEYPFKTKQMMSPVSKTQEHGLFYGDQHPGMLHEMVKPYPAPQPVRTDVAVLRYQPPPEYGVTSRPCQLPFPSTMQQHSPMSSQTSSASGPLHSVSLPLPLPMALGAPQPPPAASPSQQLGPDAFAIVERAQQMVEILTEENRVLHQELQGYYDNADKLHKFEKELQRISEAYESLVKSTTKRESLDKAMRNKLEGEIRRLHDFNRDLRDRLETANRQLSSREYEGHEDKAAEGHYASQNKEFLKEKEKLEMELAAVRTASEDHRRHIEILDQALSNAQARVIKLEEELREKQAYVEKVEKLQQALTQLQSACEKREQMERRLRTWLERELDALRTQQKHGNGQPANMPEYNAPALLELVREKEERILALEADMTKWEQKYLEESTIRHFAMNAAATAAAERDTTIINHSRNGSYGESSLEAHIWQEEEEVVQANRRCQDMEYTIKNLHAKIIEKDAMIKVLQQRSRKDAGKTDSSSLRPARSVPSIAAATGTHSRQTSLTSSQLAEEKKEEKTWKGSIGLLLGKEHHEHASAPLLPPPPTSALSSIASTTAASSAHAKTGSKDSSTQTDKSAELFWPSMASLPSRGRLSTTPAHSPVLKHPAAKGTAEKLENSPGHGKSPDHRGRVSSLLHKPEFPDGEMMEVLI DIP protein Q8IY63 original sequence version: 98 6F47AE3A13816E95 wwtr1_human WW domain-containing transcription regulator protein 1 Transcriptional coactivator with PDZ-binding motif WWTR1 TAZ protein protein human Homo sapiens Human MNPASAPPPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSSTPVPQRSMAVSQPNLVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAETLAPVQAAVNPPTMTPDMRSITNNSSDPFLNGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDFLDCLPGTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWL 630B50F46FB74C60 taz-amotl1 1 12 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey association association Fig. 2a taz-wbp2 3 12 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9GZV5:p.[Trp152Ala;Pro155Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain W A Fri Jul 22 11:03:40 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'pro155ala,trp152ala' Wed May 02 17:17:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp152ala,pro155ala' Tue Jun 30 15:42:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp152Ala;Pro155Ala]' 8 unspecified role unspecified role prey prey physical association physical association Fig. 2b taz-wbp2-1 2 12 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Fig. 2c taz-wbp2-2 4 12 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 3a,b taz-wbp2-3 4 12 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q969T9:p.Tyr200Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 19:29:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr200ala' Tue Jun 30 17:55:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr200Ala' physical association physical association Fig. 3a,c wbp2-wwtr1 5 12 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. S5 taz-tead4 4 12 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. S6