UniProt UniProt http://www.uniprot.org Molecular association of the Arabidopsis ETR1 ethylene receptor and a regulator of ethylene signaling, RTE1. Molecular association of the Arabidopsis ETR1 ethylene receptor and a regulator of ethylene signaling, RTE1. J. Biol. Chem. (0021-9258) 2010 imex curation Dong C.H., Jang M., Scharein B., Malach A., Rivarola M., Liesch J., Groth G., Hwang I., Chang C. Fig.5 : Reduced affinity of the RTE1-ETR1 interaction caused by the rte1-1 mutation (Cys161Trp) was not annotated cause the experiment involved a Trp-less ETR1 mutant (7 Trp removed). carenc@umd.edu 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions tobac-leaf Nicotiana tabacum (tobacco) leaf leaf leaf fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Dong C.H., Jang M., Scharein B., Malach A., Rivarola M., Liesch J., Groth G., Hwang I., Chang C. Fig.5 : Reduced affinity of the RTE1-ETR1 interaction caused by the rte1-1 mutation (Cys161Trp) was not annotated cause the experiment involved a Trp-less ETR1 mutant (7 Trp removed). carenc@umd.edu Accepted 2011-SEP-22 by ORCHARD J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation The described mutations in fig.2 concerned ert1-1 (C65Y) and ert1-2 (A102T) but not rte1-1 (C161Y) only described in Fig.5 and not retain for annotation (see annotation comment) Molecular association of the Arabidopsis ETR1 ethylene receptor and a regulator of ethylene signaling, RTE1. Molecular association of the Arabidopsis ETR1 ethylene receptor and a regulator of ethylene signaling, RTE1. J. Biol. Chem. (0021-9258) 2010 imex curation Dong C.H., Jang M., Scharein B., Malach A., Rivarola M., Liesch J., Groth G., Hwang I., Chang C. Fig.5 : Reduced affinity of the RTE1-ETR1 interaction caused by the rte1-1 mutation (Cys161Trp) was not annotated cause the experiment involved a Trp-less ETR1 mutant (7 Trp removed). carenc@umd.edu 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Dong C.H., Jang M., Scharein B., Malach A., Rivarola M., Liesch J., Groth G., Hwang I., Chang C. Fig.5 : Reduced affinity of the RTE1-ETR1 interaction caused by the rte1-1 mutation (Cys161Trp) was not annotated cause the experiment involved a Trp-less ETR1 mutant (7 Trp removed). carenc@umd.edu Accepted 2011-SEP-22 by ORCHARD 21-Dec-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation The described mutations in fig.2 concerned ert1-1 (C65Y) and ert1-2 (A102T) but not rte1-1 (C161Y) only described in Fig.5 and not retain for annotation (see annotation comment) Molecular association of the Arabidopsis ETR1 ethylene receptor and a regulator of ethylene signaling, RTE1. Molecular association of the Arabidopsis ETR1 ethylene receptor and a regulator of ethylene signaling, RTE1. J. Biol. Chem. (0021-9258) 2010 imex curation Dong C.H., Jang M., Scharein B., Malach A., Rivarola M., Liesch J., Groth G., Hwang I., Chang C. Fig.5 : Reduced affinity of the RTE1-ETR1 interaction caused by the rte1-1 mutation (Cys161Trp) was not annotated cause the experiment involved a Trp-less ETR1 mutant (7 Trp removed). carenc@umd.edu 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions arath-root Arabidopsis thaliana root tissue root fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Dong C.H., Jang M., Scharein B., Malach A., Rivarola M., Liesch J., Groth G., Hwang I., Chang C. Fig.5 : Reduced affinity of the RTE1-ETR1 interaction caused by the rte1-1 mutation (Cys161Trp) was not annotated cause the experiment involved a Trp-less ETR1 mutant (7 Trp removed). carenc@umd.edu Accepted 2011-SEP-22 by ORCHARD 21-Dec-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation The described mutations in fig.2 concerned ert1-1 (C65Y) and ert1-2 (A102T) but not rte1-1 (C161Y) only described in Fig.5 and not retain for annotation (see annotation comment) Molecular association of the Arabidopsis ETR1 ethylene receptor and a regulator of ethylene signaling, RTE1. Molecular association of the Arabidopsis ETR1 ethylene receptor and a regulator of ethylene signaling, RTE1. J. Biol. Chem. (0021-9258) 2010 imex curation Dong C.H., Jang M., Scharein B., Malach A., Rivarola M., Liesch J., Groth G., Hwang I., Chang C. Fig.5 : Reduced affinity of the RTE1-ETR1 interaction caused by the rte1-1 mutation (Cys161Trp) was not annotated cause the experiment involved a Trp-less ETR1 mutant (7 Trp removed). carenc@umd.edu 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions arath-leaf Arabidopsis thaliana leaf leaf leaf fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Dong C.H., Jang M., Scharein B., Malach A., Rivarola M., Liesch J., Groth G., Hwang I., Chang C. Fig.5 : Reduced affinity of the RTE1-ETR1 interaction caused by the rte1-1 mutation (Cys161Trp) was not annotated cause the experiment involved a Trp-less ETR1 mutant (7 Trp removed). carenc@umd.edu Accepted 2011-SEP-22 by ORCHARD 21-Dec-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation The described mutations in fig.2 concerned ert1-1 (C65Y) and ert1-2 (A102T) but not rte1-1 (C161Y) only described in Fig.5 and not retain for annotation (see annotation comment) ers1_arath Ethylene response sensor 1 ERS1 ERS At2g40940 Protein ERS1 T20B5.14 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MESCDCFETHVNQDDLLVKYQYISDALIALAYFSIPLELIYFVQKSAFFPYKWVLMQFGAFIILCGATHFINLWMFFMHSKAVAIVMTIAKVSCAVVSCATALMLVHIIPDLLSVKNRELFLKKKADELDREMGLILTQEETGRHVRMLTHGIRRTLDRHTILRTTLVELGKTLCLEECALWMPSQSGLYLQLSHTLSHKIQVGSSVPINLPIINELFNSAQAMHIPHSCPLAKIGPPVGRYSPPEVVSVRVPLLHLSNFQGSDWSDLSGKGYAIMVLILPTDGARKWRDHELELVENVADQVAVALSHAAILEESMHARDQLMEQNFALDKARQEAEMAVHARNDFLAVMNHEMRTPMHAIISLSSLLLETELSPEQRVMIETILKSSNLVATLISDVLDLSRLEDGSLLLENEPFSLQAIFEEVISLIKPIASVKKLSTNLILSADLPTYAIGDEKRLMQTILNIMGNAVKFTKEGYISIIASIMKPESLQELPSPEFFPVLSDSHFYLCVQVKDTGCGIHTQDIPLLFTKFVQPRTGTQRNHSGGGLGLALCKRFVGLMGGYMWIESEGLEKGCTASFIIRLGICNGPSSSSGSMALHLAAKSQTRPWNW E4F5DB384E6727B2 rte1_arath Protein REVERSION-TO-ETHYLENE SENSITIVITY1 RTE1 T19L18.12 At2g26070 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSRGRGVPMMDLKRSYDVEDRVVSVSIPSIIEADEADLWPLPEIDTKKSKFPCCIVWTPLPVVSWLAPFIGHIGLCREDGVILDFAGSNFINVDDFAFGPPARYLQLDRTKCCLPPNMGGHTCKYGFKHTDFGTARTWDNALSSSTRSFEHKTYNIFTCNCHSFVANCLNRLCYGGSMEWNMVNVAILLMIKGKWINGSSVVRSFLPCAVVTSLGVVLVGWPFLIGLSSFSLLLFAWFIIATYCFKNIIT 33A5E8AE4AF0EF93 etr1_arath Ethylene receptor 1 ETR1 T27F4.9 At1g66340 Protein ETHYLENE RESPONSE 1 Protein ETR1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEVCNCIEPQWPADELLMKYQYISDFFIAIAYFSIPLELIYFVKKSAVFPYRWVLVQFGAFIVLCGATHLINLWTFTTHSRTVALVMTTAKVLTAVVSCATALMLVHIIPDLLSVKTRELFLKNKAAELDREMGLIRTQEETGRHVRMLTHEIRSTLDRHTILKTTLVELGRTLALEECALWMPTRTGLELQLSYTLRHQHPVEYTVPIQLPVINQVFGTSRAVKISPNSPVARLRPVSGKYMLGEVVAVRVPLLHLSNFQINDWPELSTKRYALMVLMLPSDSARQWHVHELELVEVVADQVAVALSHAAILEESMRARDLLMEQNVALDLARREAETAIRARNDFLAVMNHEMRTPMHAIIALSSLLQETELTPEQRLMVETILKSSNLLATLMNDVLDLSRLEDGSLQLELGTFNLHTLFREVLNLIKPIAVVKKLPITLNLAPDLPEFVVGDEKRLMQIILNIVGNAVKFSKQGSISVTALVTKSDTRAADFFVVPTGSHFYLRVKVKDSGAGINPQDIPKIFTKFAQTQSLATRSSGGSGLGLAISKRFVNLMEGNIWIESDGLGKGCTAIFDVKLGISERSNESKQSGIPKVPAIPRHSNFTGLKVLVMDENGVSRMVTKGLLVHLGCEVTTVSSNEECLRVVSHEHKVVFMDVCMPGVENYQIALRIHEKFTKQRHQRPLLVALSGNTDKSTKEKCMSFGLDGVLLKPVSLDNIRDVLSDLLEPRVLYEGM D6ED3C4BBA87E96E ers1-rte1-1 1 6 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 1B, Table 1 etr1-rte1-7 1 6 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role neutral component neutral component P49333:p.Ala102Thr mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain A T Wed May 02 14:41:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala102thr' Tue Jun 30 17:19:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala102Thr' region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P49333:p.Cys65Trp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain C W Wed May 02 18:53:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys65trp' Tue Jun 30 15:40:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys65Trp' region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association Figs. 1B, 2, Table 1 etr1-rte1-11 4 7 unspecified role unspecified role neutral component neutral component c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 6 unspecified role unspecified role neutral component neutral component n-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 3, Table 1 etr1-rte1-12 3 7 unspecified role unspecified role neutral component neutral component c-terminal region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role neutral component neutral component n-terminal region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 3, Table 1 ers1-rte1-2 3 6 unspecified role unspecified role neutral component neutral component n-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role neutral component neutral component c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Table 1 etr1-rte1-6 2 6 unspecified role unspecified role unspecified role unspecified role region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 7 unspecified role unspecified role unspecified role unspecified role region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association Fig. 4