InnateDB InnateDB The structural basis for intramembrane assembly of an activating immunoreceptor complex. The structural basis for intramembrane assembly of an activating immunoreceptor complex. Nat. Immunol. (1529-2908) 2010 imex curation Call ME., Wucherpfennig KW., Chou JJ. chou@cmcd.hms.harvard.edu 06-Jun-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Call ME., Wucherpfennig KW., Chou JJ. chou@cmcd.hms.harvard.edu Accepted 2011-APR-27 by ORCHARD 06-Jun-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2010 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity The structural basis for intramembrane assembly of an activating immunoreceptor complex. The structural basis for intramembrane assembly of an activating immunoreceptor complex. Nat. Immunol. (1529-2908) 2010 imex curation Call ME., Wucherpfennig KW., Chou JJ. chou@cmcd.hms.harvard.edu 06-Jun-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Call ME., Wucherpfennig KW., Chou JJ. resolved on non-denaturing gel, all proteins were in-vitro translated and audiolabelled chou@cmcd.hms.harvard.edu Accepted 2011-APR-27 by ORCHARD 06-Jun-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2010 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity The structural basis for intramembrane assembly of an activating immunoreceptor complex. The structural basis for intramembrane assembly of an activating immunoreceptor complex. Nat. Immunol. (1529-2908) 2010 imex curation Call ME., Wucherpfennig KW., Chou JJ. chou@cmcd.hms.harvard.edu 06-Jun-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Call ME., Wucherpfennig KW., Chou JJ. resolved on non-denaturing gel, all proteins were in-vitro translated and audiolabelled chou@cmcd.hms.harvard.edu Accepted 2011-APR-27 by ORCHARD 06-Jun-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2010 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity The structural basis for intramembrane assembly of an activating immunoreceptor complex. The structural basis for intramembrane assembly of an activating immunoreceptor complex. Nat. Immunol. (1529-2908) 2010 imex curation Call ME., Wucherpfennig KW., Chou JJ. chou@cmcd.hms.harvard.edu 06-Jun-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Call ME., Wucherpfennig KW., Chou JJ. resolved on non-denaturing gel, all proteins were in-vitro translated and audiolabelled chou@cmcd.hms.harvard.edu Accepted 2011-APR-27 by ORCHARD 06-Jun-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2010 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity nkg2c_human NKG2-C type II integral membrane protein KLRC2 NKG2C CD159 antigen-like family member C NK cell receptor C NKG2-C-activating NK receptor protein protein human Homo sapiens Human MSKQRGTFSEVSLAQDPKRQQRKPKGNKSSISGTEQEIFQVELNLQNPSLNHQGIDKIYDCQGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPFLEQNNSSPNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHKIKDSDNAELNCAVLQVNRLKSAQCGSSMIYHCKHKL dap12-tm_nkg2c-tm_fusion_protein DAP12tm-NKG2Ctm protein protein human Homo sapiens Human CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGRLGTAEVLGIISIVLVATVLKTIVLIPFLEQN hcst_human Hematopoietic cell signal transducer DAP10 KAP10 PIK3AP DNAX-activation protein 10 Membrane protein DAP10 Transmembrane adapter protein KAP10 UNQ587/PRO1157 HCST protein protein human Homo sapiens Human MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVASLLIVGAVFLCARPRRSPAQEDGKVYINMPGRG 97786F24F8A2EE44 ki2s3_human Killer cell immunoglobulin-like receptor 2DS3 KIR2DS3 NKAT7 MHC class I NK cell receptor Natural killer-associated transcript 7 protein protein human Homo sapiens Human MSLMVISMACVGFFWLQGAWPHEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHVLIGTSVVKLPFTILLFFLLHRWCSDKKNASVMDQGPAGNRTVNREDSDEQDHQEVSYA cd3g_human T-cell surface glycoprotein CD3 gamma chain CD3G T3G T-cell receptor T3 gamma chain protein protein human Homo sapiens Human MEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLFAEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN cd3e_human T-cell surface glycoprotein CD3 epsilon chain CD3E T3E T-cell surface antigen T3/Leu-4 epsilon chain protein protein human Homo sapiens Human MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI A1603D01CE9957D7 nkg2d_human NKG2-D type II integral membrane protein KLRK1 NKG2D NKG2-D-activating NK receptor NK cell receptor D Killer cell lectin-like receptor subfamily K member 1 D12S2489E protein protein human Homo sapiens Human MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVAIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV DIP protein P26718 original sequence version: 106 C22F6BD533D7800E cd3d_human T-cell surface glycoprotein CD3 delta chain CD3D T3D T-cell receptor T3 delta chain protein protein human Homo sapiens Human MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK DIP protein P04234 original sequence version: 154 tyobp_human TYRO protein tyrosine kinase-binding protein TYROBP DAP12 KARAP DNAX-activation protein 12 Killer-activating receptor-associated protein protein protein human Homo sapiens Human MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK 267CB1C1756F89F0 tyrobp 1 13 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region 2h label 2h label deuterium D2 2H2 2H2 deuterium D2 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2D, 2E, 3A, 3C, S2C, S3, Table 1. klrc2-tyrobp-1 1 6 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region 2h label 2h label deuterium D2 2H2 2H2 deuterium D2 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region 2h label 2h label deuterium D2 2H2 2H2 deuterium D2 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2D, 2E, 3A, 3C, S2C, S3, Table 1. A pure disulfide-linked TYROBP transmembrane(TM)-TYROBP(TM)-KLRC2(TM) trimeric peptide product was used in the study. tyrobp-tyrobp 3 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O43914:p.Thr54Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T A Wed May 02 17:54:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr54ala' Tue Jun 30 15:35:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr54Ala' O43914:p.Ala58Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain A F Wed May 02 19:19:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala58phe' Tue Jun 30 18:17:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala58Phe' physical association physical association Fig. 2B both DAP12 monomer and dimer were detected in the non-denaturing gel tyrobp-tyrobp-1 3 8 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait O43914:p.Ala58Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain A F Wed May 02 17:37:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala58phe' Tue Jun 30 20:01:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala58Phe' region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O43914:p.Thr54Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T A Wed May 02 15:04:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr54ala' Tue Jun 30 16:06:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr54Ala' physical association physical association Fig. 2C both DAP12 monomer and dimer were detected in the non-denaturing gel tyrobp-tyrobp-3 4 13 unspecified role unspecified role neutral component neutral component O43914:p.[Gly41Phe;Gly45Phe;Gly49Phe] mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain G F certain certain sequence position certain certain certain sequence position certain G F certain certain sequence position certain certain certain sequence position certain G F Wed May 02 16:26:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly41phe,gly45phe,gly49phe' Tue Jun 30 18:23:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly41Phe;Gly45Phe;Gly49Phe]' O43914:p.[Asp50Ala;Thr54Ala] mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain T A Wed May 02 19:28:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp50ala,thr54ala' Tue Jun 30 15:45:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp50Ala;Thr54Ala]' region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O43914:p.Leu16Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A Wed May 02 17:53:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu16ala' Tue Jun 30 16:28:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu16Ala' O43914:p.Ile46_Val47delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain IV AA Wed May 02 14:36:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile_val46-47ala_ala' Tue Jun 30 16:06:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile46_Val47delinsAlaAla' direct interaction direct interaction Fig. 2F hcst-hcst 3 11 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait Q9UBK5:p.Asp57Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain D A Wed May 02 15:27:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp57ala' Tue Jun 30 20:00:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp57Ala' region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 5D native gel on left showed oxidized NKG2D as a defused band, +DTT treatment (right) was performed for quantification of NKG2D proteins. cd3e-cd3d 2 12 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 5E TCRa was also co-immunoprecipitated in this experiment but was not included as a participant since the specific cDNA isoform/variable region could not be determined from the article nor from author correspondence cd3e-cd3g 2 9 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 5F TCRb was also co-immunoprecipitated in this experiment but was not included as a participant since the specific cDNA isoform/variable region could not be determined from the article nor from author correspondence