IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ C. elegans SWAN-1 Binds to EGL-9 and regulates HIF-1-mediated resistance to the bacterial pathogen Pseudomonas aeruginosa PAO1. C. elegans SWAN-1 Binds to EGL-9 and regulates HIF-1-mediated resistance to the bacterial pathogen Pseudomonas aeruginosa PAO1. PLoS Pathog. (1553-7366) 2010 imex curation Shao Z., Zhang Y., Ye Q., Saldanha JN., Powell-Coffman JA. The amino acid numbers for the EGL-9 catalytic domain are not stated in the paper and have been taken from InterPro. EGL-9:Catalytic domain aa nos entered were based on Interpro domain, which contains His487- an amino acid stated to be in the central core of the catalytic domain in a previous paper by the same author. japc@iastate.edu 06-April-2011: Contacted by JYOTI. jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Shao Z., Zhang Y., Ye Q., Saldanha JN., Powell-Coffman JA. The amino acid numbers for the EGL-9 catalytic domain are not stated in the paper and have been taken from InterPro. EGL-9:Catalytic domain aa nos entered were based on Interpro domain, which contains His487- an amino acid stated to be in the central core of the catalytic domain in a previous paper by the same author. EGL-9:Catalytic domain aa nos entered were based on Interpro domain, which contains His487- an amino acid stated to be in the central core of the catalytic domain in a previous paper by the same author. japc@iastate.edu Accepted 2011-FEB-18 by JYOTI 06-April-2011: Contacted by JYOTI. PLoS Pathog. (1553-7366) 2010 jyoti Only protein-protein interactions imex curation C. elegans SWAN-1 Binds to EGL-9 and regulates HIF-1-mediated resistance to the bacterial pathogen Pseudomonas aeruginosa PAO1. C. elegans SWAN-1 Binds to EGL-9 and regulates HIF-1-mediated resistance to the bacterial pathogen Pseudomonas aeruginosa PAO1. PLoS Pathog. (1553-7366) 2010 imex curation Shao Z., Zhang Y., Ye Q., Saldanha JN., Powell-Coffman JA. The amino acid numbers for the EGL-9 catalytic domain are not stated in the paper and have been taken from InterPro. EGL-9:Catalytic domain aa nos entered were based on Interpro domain, which contains His487- an amino acid stated to be in the central core of the catalytic domain in a previous paper by the same author. japc@iastate.edu 06-April-2011: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Shao Z., Zhang Y., Ye Q., Saldanha JN., Powell-Coffman JA. The amino acid numbers for the EGL-9 catalytic domain are not stated in the paper and have been taken from InterPro. EGL-9:Catalytic domain aa nos entered were based on Interpro domain, which contains His487- an amino acid stated to be in the central core of the catalytic domain in a previous paper by the same author. EGL-9:Catalytic domain aa nos entered were based on Interpro domain, which contains His487- an amino acid stated to be in the central core of the catalytic domain in a previous paper by the same author. japc@iastate.edu Accepted 2011-FEB-18 by JYOTI 06-April-2011: Contacted by JYOTI. PLoS Pathog. (1553-7366) 2010 jyoti Only protein-protein interactions imex curation q93758_caeel swan-1 CELE_F53C11.8 F53C11.8 protein protein caeel Caenorhabditis elegans MATNGHAVNGEAHVMQQVAQQPAPPGPLAPQGIGRQNEIVIGGRDRRCEIYKFTSDQQLYASAWSNKNDIKFRLAVGTVSDVSVNPCAANKVSIVQLKDETGELVETASFPMEFPANAVGFIPDPDNVYPDLIATTSDCLRLWRVVDGKVHPDAVMINNTNSQYGSALTSFDWNELEPRYIGVSSVDTTCTIYDVEVGCAIGQTKPTAPFTLKTQLIAHDKPVHDIEFAKINGGRDHFATVGADGSARMFDLRHLNHSTIVYEDPNKEKLQRLSWNKQEPYFMALFAENSQEVQILDIRMPCNILCRLRNHTGPVNGIAWAPHSPHHICTAGDDSQALIWDLQQVPRPVDDPILAYSAGGEVNQIHWGPVHSNWIAICFNKTLEILRV 0228CF52C8BDB6C2 egl9_caeel Hypoxia-inducible factor prolyl hydroxylase egl-9 Egg-laying defective protein 9 Hypoxia-inducible factor-proline dioxygenase F22E12.4 protein protein caeel Caenorhabditis elegans MSSAPNDDCEIDKGTPSTASLFTTLMLSQPSSSTAVLQCTYCGSSCTSSQLQTCLFCGTVAYCSKEHQQLDWLTHKMICKSLQTSGMVPSNLMPQAAPAVMAPIPPTVSFDDPALTTSLLLSLQNNPILNQTISNFPPTFSITSKTEPEPSIPIQIPQRISSTSTVPFSSEGSAFKPYRNTHVFNSISSESMSSMCTSHEASLEHMSSASLAMFPTSSTAQSDISRLAQVLSLAGDSPASLALVTTSVPSTASTATIPPPATTTSSATSSGKSETITVGKEKIIQTDDPDIQIIETEGGSKPTVSRTRKRPTPSNSADPKINYKDHNKNVVYSTTLQEHQKHLQNRGLALSIHQAMVLRLRYIAEHVIRSLNEFGWAVVDNFLGSDHYKFTAKEIERLYERGLFSPGQLMEAKHKDEFHIKDIRSDHIYWYDGYDGRAKDAATVRLLISMIDSVIQHFKKRIDHDIGGRSRAMLAIYPGNGTRYVKHVDNPVKDGRCITTIYYCNENWDMATDGGTLRLYPETSMTPMDIDPRADRLVFFWSDRRNPHEVMPVFRHRFAITIWYMDKSERDKALAKGKESDAACASKKENDPTSSSLNSLIGSLLRPRKNPSTHDLSKLDLRLFPSTSSDPALVSAADEDRVDISADFQSTSSLAHPESTDSGVSLSTFNVAHNHMERTTSLQSISDHFRSERSHERRSSTSSDQDLDEGLPPPPSTNPEYYI 15F65F197F9D1D52 egl_9-swan_1 1 4 unspecified role unspecified role bait bait catalytic_domain sufficient to bind sufficient binding region sufficient to bind range range range range 3 unspecified role unspecified role prey prey n-terminal_wd1-3 required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range physical association physical association Fig 6A,B. swan_1-egl_9 2 4 unspecified role unspecified role prey prey catalytic_domain sufficient to bind sufficient binding region sufficient to bind range range range range region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined caeel Caenorhabditis elegans physical association physical association Fig 6C.