UniProt UniProt http://www.uniprot.org Identification of two amino acids in the C-terminal domain of mouse CRY2 essential for PER2 interaction. Identification of two amino acids in the C-terminal domain of mouse CRY2 essential for PER2 interaction. BMC Mol. Biol. (null) 2010 imex curation Ozber N., Baris I., Tatlici G., Gur I., Kilinc S., Unal E.B., Kavakli I.H. hkavakli@ku.edu.tr 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ozber N., Baris I., Tatlici G., Gur I., Kilinc S., Unal E.B., Kavakli I.H. hkavakli@ku.edu.tr Accepted 2011-SEP-30 by ORCHARD BMC Mol. Biol. (null) 2010 Only protein-protein interactions imex curation Identification of two amino acids in the C-terminal domain of mouse CRY2 essential for PER2 interaction. Identification of two amino acids in the C-terminal domain of mouse CRY2 essential for PER2 interaction. BMC Mol. Biol. (null) 2010 imex curation Ozber N., Baris I., Tatlici G., Gur I., Kilinc S., Unal E.B., Kavakli I.H. hkavakli@ku.edu.tr 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ozber N., Baris I., Tatlici G., Gur I., Kilinc S., Unal E.B., Kavakli I.H. hkavakli@ku.edu.tr Accepted 2011-SEP-30 by ORCHARD 21-Dec-2011: Contacted by JYOTI. BMC Mol. Biol. (null) 2010 Only protein-protein interactions imex curation bmal1_mouse Aryl hydrocarbon receptor nuclear translocator-like protein 1 Arntl Bmal1 Brain and muscle ARNT-like 1 Arnt3 protein protein mouse Mus musculus Mouse MADQRMDISSTISDFMSPGPTDLLSGSLGTSGVDCNRKRKGSATDYQLDDFAFEESMDTDKDDPHGRLEYAEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFASTCSKKKDRKSFCTIHSTGYLKSWPPTKMGLDEDNEPDNEGCNLSCLVAIGRLHSHMVPQPANGEIRVKSMEYVSRHAIDGKFVFVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRWFSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTAPPHSMDSMLPSGEGGPKRTHPTVPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSTGLLPGQAQETPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL DIP protein Q9WTL8 original sequence version: 134 DIP protein Q9WTL8 original sequence version: 123 DIP protein Q9WTL8 original sequence version: 94 DIP protein Q9WTL8 original sequence version: 128 DIP protein Q9WTL8 original sequence version: 144 DIP protein Q9WTL8 original sequence version: 145 9669C3712A95C2DE per2_mouse Period circadian protein homolog 2 Per2 Circadian clock protein PERIOD 2 protein protein mouse Mus musculus Mouse MNGYVDFSPSPTSPTKEPGAPQPTQAVLQEDVDMSSGSSGNENCSTGRDSQGSDCDDNGKELRMLVESSNTHPSPDDAFRLMMTEAEHNPSTSGCSSEQSAKADAHKELIRTLKELKVHLPADKKAKGKASTLATLKYALRSVKQVKANEEYYQLLMSSESQPCSVDVPSYSMEQVEGITSEYIVKNADMFAVAVSLVSGKILYISNQVASIFHCKKDAFSDAKFVEFLAPHDVSVFHSYTTPYKLPPWSVCSGLDSFTQECMEEKSFFCRVSVGKHHENEIRYQPFRMTPYLVKVQEQQGAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQAVDERAVPLLGYLPQDLIETPVLVQLHPSDRPLMLAIHKKILQAGGQPFDYSPIRFRTRNGEYITLDTSWSSFINPWSRKISFIIGRHKVRVGPLNEDVFAAPPCPEEKTPHPSVQELTEQIHRLLMQPVPHSGSSGYGSLGSNGSHEHLMSQTSSSDSNGQEESHRRRSGIFKTSGKIQTKSHVSHESGGQKEASVAEMQSSPPAQVKAVTTIERDSSGASLPKASFPEELAYKNQPPCSYQQISCLDSVIRYLESCSEAATLKRKCEFPANIPSRKATVSPGLHSGEAARPSKVTSHTEVSAHLSSLTLPGKAESVVSLTSQCSYSSTIVHVGDKKPQPELETVEDMASGPESLDGAAGGLSQEKGPLQKLGLTKEVLAAHTQKEEQGFLQRFREVSRLSALQAHCQNYLQERSRAQASDRGLRNTSGLESSWKKTGKNRKLKSKRVKTRDSSESTGSGGPVSHRPPLMGLNATAWSPSDTSQSSCPSAPFPTAVPAYPLPVFQAPGIVSTPGTVVAPPAATHTGFTMPVVPMGTQPEFAVQPLPFAAPLAPVMAFMLPSYPFPPATPNLPQAFLPSQPHFPAHPTLASEITPASQAEFPSRTSTLRQPCACPVTPPAGTVALGRASPPLFQSRGSSPLQLNLLQLEEAPEGSTGAAGTLGTTGTAASGLDCTSGTSRDRQPKAPPTCNEPSDTQNSDAISTSSDLLNLLLGEDLCSATGSALSRSGASATSDSLGSSSLGFGTSQSGAGSSDTSHTSKYFGSIDSSENNHKAKMIPDTEESEQFIKYVLQDPIWLLMANTDDSIMMTYQLPSRDLQAVLKEDQEKLKLLQRSQPRFTEGQRRELREVHPWVHTGGLPTAIDVTGCVYCESEEKGNICLPYEEDSPSPGLCDTSEAKEEEGEQLTGPRIEAQT DIP protein O54943 original sequence version: 120 DIP protein O54943 original sequence version: 83 DIP protein O54943 original sequence version: 87 DIP protein O54943 original sequence version: 104 DIP protein O54943 original sequence version: 111 DIP protein O54943 original sequence version: 114 DIP protein O54943 original sequence version: 98 554B8AFF036CF7FB clock_mouse Circadian locomoter output cycles protein kaput Clock protein protein mouse Mus musculus Mouse MVFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKETTAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVRFIGNFKSLTSVSTSTHNGFEGTIQRTHRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEALERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPAHEKMTQRRSSFSSQSINSQSVGPSLTQPAMSQAANLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEANIHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSNIQQLTPVNMQGQVVPANQVQSGHISTGQHMIQQQTLQSTSTQQSQQSVMSGHSQQTSLPSQTPSTLTAPLYNTMVISQPAAGSMVQIPSSMPQNSTQSATVTTFTQDRQIRFSQGQQLVTKLVTAPVACGAVMVPSTMLMGQVVTAYPTFATQQQQAQTLSVTQQQQQQQQQPPQQQQQQQQSSQEQQLPSVQQPAQAQLGQPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPPSHHQQHQPQQQQQLPRHRTDSLTDPSKVQPQ DIP protein O08785 original sequence version: 149 DIP protein O08785-1 original sequence version: 138 DIP protein O08785 original sequence version: 138 DIP protein O08785 original sequence version: 108 DIP protein O08785 original sequence version: 143 DIP protein O08785 original sequence version: 155 DIP protein O08785 original sequence version: 159 DIP protein O08785 original sequence version: 160 9864D947049742F4 cry2_mouse Cryptochrome-2 Cry2 Kiaa0658 protein protein mouse Mus musculus Mouse MAAAAVVAATVPAQSMGADGASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPGSSQAGSISNTGPRALSSGPASPKRKLEAAEEPPGEELTKRARVTEMPTQEPASKDS DIP protein Q9R194 original sequence version: 77 DIP protein Q9R194 original sequence version: 94 DIP protein Q9R194 original sequence version: 105 DIP protein Q9R194 original sequence version: 121 DIP protein Q9R194 original sequence version: 87 4D6E7B199C392CBB per2-cry2 1 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey Q9R194:p.[Ser495Gly;Leu497Pro;Ile499Thr;Arg501Gln;Lys503Arg;Ile505Thr;Leu509Pro] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S G certain certain sequence position certain certain certain sequence position certain L P certain certain sequence position certain certain certain sequence position certain I T certain certain sequence position certain certain certain sequence position certain R Q certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain I T certain certain sequence position certain certain certain sequence position certain L P Wed May 02 15:46:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser495gly,leu497pro,ile499thr,arg501gln,lys503arg,ile505thr,leu509pro' Tue Jun 30 17:25:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser495Gly;Leu497Pro;Ile499Thr;Arg501Gln;Lys503Arg;Ile505Thr;Leu509Pro]' Q9R194:p.[Ile499Thr;Arg501Gln;Ile505Thr;Leu509Pro] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain I T certain certain sequence position certain certain certain sequence position certain R Q certain certain sequence position certain certain certain sequence position certain I T certain certain sequence position certain certain certain sequence position certain L P Wed May 02 14:50:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile499thr,arg501gln,ile505thr,leu509pro' Tue Jun 30 19:10:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile499Thr;Arg501Gln;Ile505Thr;Leu509Pro]' c-terminus required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain Q9R194:p.[Leu497Pro;Ile499Thr;Arg501Gln;Ile505Thr;Leu509Pro] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L P certain certain sequence position certain certain certain sequence position certain I T certain certain sequence position certain certain certain sequence position certain R Q certain certain sequence position certain certain certain sequence position certain I T certain certain sequence position certain certain certain sequence position certain L P Wed May 02 17:09:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu497pro,ile499thr,arg501gln,ile505thr,leu509pro' Tue Jun 30 17:50:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu497Pro;Ile499Thr;Arg501Gln;Ile505Thr;Leu509Pro]' Q9R194:p.[Ile499Thr;Arg501Gln] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain I T certain certain sequence position certain certain certain sequence position certain R Q Wed May 02 18:01:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile499thr,arg501gln' Tue Jun 30 18:15:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile499Thr;Arg501Gln]' Q9R194:p.[Glu493Gly;Leu497Pro;Lys503Arg;Ile505Thr;Leu509Pro] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain E G certain certain sequence position certain certain certain sequence position certain L P certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain I T certain certain sequence position certain certain certain sequence position certain L P Wed May 02 15:33:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu493gly,leu497pro,lys503arg,ile505thr,leu509pro' Tue Jun 30 17:14:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu493Gly;Leu497Pro;Lys503Arg;Ile505Thr;Leu509Pro]' Q9R194:p.[Ser495Gly;Leu497Pro;Ile499Thr;Lys503Arg;Ile505Thr;Leu509Pro] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S G certain certain sequence position certain certain certain sequence position certain L P certain certain sequence position certain certain certain sequence position certain I T certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain I T certain certain sequence position certain certain certain sequence position certain L P Wed May 02 16:33:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser495gly,leu497pro,ile499thr,lys503arg,ile505thr,leu509pro' Tue Jun 30 17:33:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser495Gly;Leu497Pro;Ile499Thr;Lys503Arg;Ile505Thr;Leu509Pro]' Q9R194:p.[Arg501Gln;Lys503Arg] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain R Q certain certain sequence position certain certain certain sequence position certain K R Wed May 02 16:54:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg501gln,lys503arg' Tue Jun 30 18:53:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg501Gln;Lys503Arg]' Q9R194:p.[Ile499Thr;Lys503Arg;Ile505Thr;Leu509Pro] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain I T certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain I T certain certain sequence position certain certain certain sequence position certain L P Wed May 02 19:39:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile499thr,lys503arg,ile505thr,leu509pro' Tue Jun 30 18:10:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile499Thr;Lys503Arg;Ile505Thr;Leu509Pro]' physical association physical association Figs. 2b, 5 and table 1 arntl-cry2 1 6 unspecified role unspecified role prey prey c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role bait bait physical association physical association 2b and 3d arntl-clock-1 1 3 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 1b per2-cry2-1 2 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3c