MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The PP1-R6 protein phosphatase holoenzyme is involved in the glucose-induced dephosphorylation and inactivation of AMP-activated protein kinase, a key regulator of insulin secretion, in MIN6 beta cells. The PP1-R6 protein phosphatase holoenzyme is involved in the glucose-induced dephosphorylation and inactivation of AMP-activated protein kinase, a key regulator of insulin secretion, in MIN6 beta cells. FASEB J. (0892-6638) 2010 Garcia-Haro L., Garcia-Gimeno MA., Neumann D., Beullens M., Bollen M., Sanz P. partial coverage rapid curation mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Garcia-Haro L., Garcia-Gimeno MA., Neumann D., Beullens M., Bollen M., Sanz P. Accepted 2013-AUG-29 by ORCHARD FASEB J. (0892-6638) 2010 partial coverage rapid curation aakb1_mouse 5'-AMP-activated protein kinase subunit beta-1 Prkab1 protein protein mouse Mus musculus Mouse MGNTSSERAALERQAGHKTPRRDSSGGAKDGDRPKILMDSPEDADIFHSEEIKAPEKEEFLAWQHDLEANDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYMSKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 6B520A95A0A844E5 ppr3d_human Protein phosphatase 1 regulatory subunit 3D Protein phosphatase 1 regulatory subunit 6 Protein phosphatase 1-binding subunit R6 PPP1R3D PPP1R6 protein protein human Homo sapiens Human MSRGPSSAVLPSALGSRKLGPRSLSCLSDLDGGVALEPRACRPPGSPGRAPPPTPAPSGCDPRLRPIILRRARSLPSSPERRQKAAGAPGAACRPGCSQKLRVRFADALGLELAQVKVFNAGDDPSVPLHVLSRLAINSDLCCSSQDLEFTLHCLVPDFPPPVEAADFGERLQRQLVCLERVTCSDLGISGTVRVCNVAFEKQVAVRYTFSGWRSTHEAVARWRGPAGPEGTEDVFTFGFPVPPFLLELGSRVHFAVRYQVAGAEYWDNNDHRDYSLTCRNHALHMPRGECEESWIHFI DB848FB1CF55E49E ppp1r3d-prkab1 1 PPP1R6 3 unspecified role unspecified role bait bait AMPKbeta-1 2 unspecified role unspecified role prey prey physical association physical association f6b homomint mint