IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Identification of FBXO25-interacting proteins using an integrated proteomics approach. Identification of FBXO25-interacting proteins using an integrated proteomics approach. Proteomics (1615-9853) 2010 imex curation Teixeira FR., Yokoo S., Gartner CA., Manfiolli AO., Baqui MM., Assmann EM., Maragno AL., Yu H., de Lanerolle P., Kobarg J., Gygi SP., Gomes MD. GST/HA-FBXO25/WT-FLAG, GST/HA-FBXO25-delF-FLAG constructs used for purification by anti FLAG M2 affinity gel resin. mdamario@fmrp.usp.br 19-Sept-2012: Contacted by IntAct-Help. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Teixeira FR., Yokoo S., Gartner CA., Manfiolli AO., Baqui MM., Assmann EM., Maragno AL., Yu H., de Lanerolle P., Kobarg J., Gygi SP., Gomes MD. GST/HA-FBXO25/WT-FLAG, GST/HA-FBXO25-delF-FLAG constructs used for purification by anti FLAG M2 affinity gel resin. mdamario@fmrp.usp.br Accepted 2012-AUG-07 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. Proteomics (1615-9853) 2010 orchard Only protein-protein interactions imex curation Identification of FBXO25-interacting proteins using an integrated proteomics approach. Identification of FBXO25-interacting proteins using an integrated proteomics approach. Proteomics (1615-9853) 2010 imex curation Teixeira FR., Yokoo S., Gartner CA., Manfiolli AO., Baqui MM., Assmann EM., Maragno AL., Yu H., de Lanerolle P., Kobarg J., Gygi SP., Gomes MD. GST/HA-FBXO25/WT-FLAG, GST/HA-FBXO25-delF-FLAG constructs used for purification by anti FLAG M2 affinity gel resin. mdamario@fmrp.usp.br 19-Sept-2012: Contacted by IntAct-Help. orchard Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down western blot western blot Immuno blot Immuno blot Teixeira FR., Yokoo S., Gartner CA., Manfiolli AO., Baqui MM., Assmann EM., Maragno AL., Yu H., de Lanerolle P., Kobarg J., Gygi SP., Gomes MD. GST/HA-FBXO25/WT-FLAG, GST/HA-FBXO25-delF-FLAG constructs used for purification by anti FLAG M2 affinity gel resin. mdamario@fmrp.usp.br Accepted 2012-AUG-07 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. Proteomics (1615-9853) 2010 orchard Only protein-protein interactions imex curation Identification of FBXO25-interacting proteins using an integrated proteomics approach. Identification of FBXO25-interacting proteins using an integrated proteomics approach. Proteomics (1615-9853) 2010 imex curation Teixeira FR., Yokoo S., Gartner CA., Manfiolli AO., Baqui MM., Assmann EM., Maragno AL., Yu H., de Lanerolle P., Kobarg J., Gygi SP., Gomes MD. GST/HA-FBXO25/WT-FLAG, GST/HA-FBXO25-delF-FLAG constructs used for purification by anti FLAG M2 affinity gel resin. mdamario@fmrp.usp.br 19-Sept-2012: Contacted by IntAct-Help. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Teixeira FR., Yokoo S., Gartner CA., Manfiolli AO., Baqui MM., Assmann EM., Maragno AL., Yu H., de Lanerolle P., Kobarg J., Gygi SP., Gomes MD. GST/HA-FBXO25/WT-FLAG, GST/HA-FBXO25-delF-FLAG constructs used for purification by anti FLAG M2 affinity gel resin. mdamario@fmrp.usp.br Accepted 2012-AUG-07 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. Proteomics (1615-9853) 2010 orchard Only protein-protein interactions imex curation Identification of FBXO25-interacting proteins using an integrated proteomics approach. Identification of FBXO25-interacting proteins using an integrated proteomics approach. Proteomics (1615-9853) 2010 imex curation Teixeira FR., Yokoo S., Gartner CA., Manfiolli AO., Baqui MM., Assmann EM., Maragno AL., Yu H., de Lanerolle P., Kobarg J., Gygi SP., Gomes MD. GST/HA-FBXO25/WT-FLAG, GST/HA-FBXO25-delF-FLAG constructs used for purification by anti FLAG M2 affinity gel resin. mdamario@fmrp.usp.br 19-Sept-2012: Contacted by IntAct-Help. orchard Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Teixeira FR., Yokoo S., Gartner CA., Manfiolli AO., Baqui MM., Assmann EM., Maragno AL., Yu H., de Lanerolle P., Kobarg J., Gygi SP., Gomes MD. GST/HA-FBXO25/WT-FLAG, GST/HA-FBXO25-delF-FLAG constructs used for purification by anti FLAG M2 affinity gel resin. mdamario@fmrp.usp.br Accepted 2012-AUG-07 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. Proteomics (1615-9853) 2010 orchard Only protein-protein interactions imex curation Identification of FBXO25-interacting proteins using an integrated proteomics approach. Identification of FBXO25-interacting proteins using an integrated proteomics approach. Proteomics (1615-9853) 2010 imex curation Teixeira FR., Yokoo S., Gartner CA., Manfiolli AO., Baqui MM., Assmann EM., Maragno AL., Yu H., de Lanerolle P., Kobarg J., Gygi SP., Gomes MD. GST/HA-FBXO25/WT-FLAG, GST/HA-FBXO25-delF-FLAG constructs used for purification by anti FLAG M2 affinity gel resin. mdamario@fmrp.usp.br 19-Sept-2012: Contacted by IntAct-Help. orchard Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down fingerprinting peptide massfingerprinting fingerprinting Teixeira FR., Yokoo S., Gartner CA., Manfiolli AO., Baqui MM., Assmann EM., Maragno AL., Yu H., de Lanerolle P., Kobarg J., Gygi SP., Gomes MD. GST/HA-FBXO25/WT-FLAG, GST/HA-FBXO25-delF-FLAG constructs used for purification by anti FLAG M2 affinity gel resin. mdamario@fmrp.usp.br Accepted 2012-AUG-07 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. Proteomics (1615-9853) 2010 orchard Only protein-protein interactions imex curation cand1_human Cullin-associated NEDD8-dissociated protein 1 KIAA0829 TIP120 TIP120A Cullin-associated and neddylation-dissociated protein 1 p120 CAND1 TBP-interacting protein of 120 kDa A CAND1 protein protein human Homo sapiens Human MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKEQLRDISSIGLKTVIGELPPASSGSALAANVCKKITGRLTSAIAKQEDVSVQLEALDIMADMLSRQGGLLVNFHPSILTCLLPQLTSPRLAVRKRTIIALGHLVMSCGNIVFVDLIEHLLSELSKNDSMSTTRTYIQCIAAISRQAGHRIGEYLEKIIPLVVKFCNVDDDELREYCIQAFESFVRRCPKEVYPHVSTIINICLKYLTYDPNYNYDDEDEDENAMDADGGDDDDQGSDDEYSDDDDMSWKVRRAAAKCLDAVVSTRHEMLPEFYKTVSPALISRFKEREENVKADVFHAYLSLLKQTRPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPGALTQHIPVLVPGIIFSLNDKSSSSNLKIDALSCLYVILCNHSPQVFHPHVQALVPPVVACVGDPFYKITSEALLVTQQLVKVIRPLDQPSSFDATPYIKDLFTCTIKRLKAADIDQEVKERAISCMGQIICNLGDNLGSDLPNTLQIFLERLKNEITRLTTVKALTLIAGSPLKIDLRPVLGEGVPILASFLRKNQRALKLGTLSALDILIKNYSDSLTAAMIDAVLDELPPLISESDMHVSQMAISFLTTLAKVYPSSLSKISGSILNELIGLVRSPLLQGGALSAMLDFFQALVVTGTNNLGYMDLLRMLTGPVYSQSTALTHKQSYYSIAKCVAALTRACPKEGPAVVGQFIQDVKNSRSTDSIRLLALLSLGEVGHHIDLSGQLELKSVILEAFSSPSEEVKSAASYALGSISVGNLPEYLPFVLQEITSQPKRQYLLLHSLKEIISSASVVGLKPYVENIWALLLKHCECAEEGTRNVVAECLGKLTLIDPETLLPRLKGYLISGSSYARSSVVTAVKFTISDHPQPIDPLLKNCIGDFLKTLEDPDLNVRRVALVTFNSAAHNKPSLIRDLLDTVLPHLYNETKVRKELIREVEMGPFKHTVDDGLDIRKAAFECMYTLLDSCLDRLDIFEFLNHVEDGLKDHYDIKMLTFLMLVRLSTLCPSAVLQRLDRLVEPLRATCTTKVKANSVKQEFEKQDELKRSAMRAVAALLTIPEAEKSPLMSEFQSQISSNPELAAIFESIQKDSSSTNLESMDTS DIP protein Q86VP6 original sequence version: 120 DIP protein Q86VP6 original sequence version: 77 DIP protein Q86VP6 original sequence version: 122 FE344558F72D79D8 q8tcj0-2 F-box only protein 25 FBXO25 FBX25 protein protein human Homo sapiens Human MPFLGQDWRSPGWSWIKTEDGWKRCESCSQKLERENNRCNISHSIILNSEDGEIFNNEEHEYASKKRKKDHFRNDTNTQSFYREKWIYVHKESTKERHGYCTLGEAFNRLDFSSAIQDIRRFNYVVKLLQLIAKSQLTSLSGVAQKNYFNILDKIVQKVLDDHHNPRLIKDLLQDLSSTLCILIRGVGKSVLVGNINIWICRLETILAWQQQLQDLQMTKQVNNGLTLSDLPLHMLNNILYRFSDGWDIITLGQVTPTLYMLSEDRQLWKKLCQYHFAEKQFCRHLILSEKGHIEWKLMYFALQKHYPAKEQYGDTLHFCRHCSILFWKDSGHPCTAADPDSCFTPVSPQHFIDLFKF No experimental confirmation available 4222DEAEA61A7487 skp1_human S-phase kinase-associated protein 1 SKP1 EMC19 OCP2 SKP1A TCEB1L Cyclin-A/CDK2-associated protein p19 p19skp1 RNA polymerase II elongation factor-like protein Organ of Corti protein 2 Organ of Corti protein II SIII Transcription elongation factor B polypeptide 1-like protein protein human Homo sapiens Human MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK C794D62AFB75528A actb_human Actin, cytoplasmic 1 ACTB Beta-actin protein protein human Homo sapiens Human MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF DIP protein P60709 original sequence version: null DIP protein P60709 original sequence version: 63 DIP protein P60709 original sequence version: 128 DIP protein P60709 original sequence version: 129 DIP protein P60709 original sequence version: 58 DIP protein P60709 original sequence version: 66 DIP protein P60709 original sequence version: 88 DIP protein P60709 original sequence version: 89 DIP protein P60709 original sequence version: 86 DIP protein P60709 original sequence version: 138 DIP protein P60709 original sequence version: 112 6AFD05CA94E360E2 q8tcj0-3 F-box only protein 25 FBXO25 FBX25 protein protein human Homo sapiens Human MEKYSIMKSMNMHRKKGKRTILEMTQILKRHGYCTLGEAFNRLDFSSAIQDIRRFNYVVKLLQLIAKSQLTSLSGVAQKNYFNILDKIVQKVLDDHHNPRLIKDLLQDLSSTLCILIRGVGKSVLVGNINIWICRLETILAWQQQLQDLQMTKQVNNGLTLSDLPLHMLNNILYRFSDGWDIITLGQVTPTLYMLSEDRQLWKKLCQYHFAEKQFCRHLILSEKGHIEWKLMYFALQKHYPAKEQYGDTLHFCRHCSILFWKDSGHPCTAADPDSCFTPVSPQHFIDLFKF No experimental confirmation available. 4222DEAEA61A7487 cul1_human Cullin-1 CUL1 protein protein human Homo sapiens Human MSSTRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAALNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDEVELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA DIP protein Q13616 original sequence version: 144 DIP protein Q13616 original sequence version: 133 DIP protein Q13616 original sequence version: null DIP protein Q13616 original sequence version: 135 DIP protein Q13616 original sequence version: 98 DIP protein Q13616 original sequence version: 110 DIP protein Q13616 original sequence version: 146 DIP protein Q13616 original sequence version: 148 DIP protein Q13616 original sequence version: 100 DIP protein Q13616 original sequence version: 85 DIP protein Q13616 original sequence version: 114 DIP protein Q13616 original sequence version: 119 DIP protein Q13616 original sequence version: 136 DIP protein Q13616 original sequence version: 117 DIP protein Q13616 original sequence version: 99 DIP protein Q13616 original sequence version: 108 6625A1FFA7799BBA fbx25_human F-box only protein 25 FBXO25 FBX25 protein protein human Homo sapiens Human MPFLGQDWRSPGWSWIKTEDGWKRCESCSQKLERENNRCNISHSIILNSEDGEIFNNEEHEYASKKRKKDHFRNDTNTQSFYREKWIYVHKESTKERHGYCTLGEAFNRLDFSSAIQDIRRFNYVVKLLQLIAKSQLTSLSGVAQKNYFNILDKIVQKVLDDHHNPRLIKDLLQDLSSTLCILIRGVGKSVLVGNINIWICRLETILAWQQQLQDLQMTKQVNNGLTLSDLPLHMLNNILYRFSDGWDIITLGQVTPTLYMLSEDRQLWKKLCQYHFAEKQFCRHLILSEKGHIEWKLMYFALQKHYPAKEQYGDTLHFCRHCSILFWKDYHLALLFKDSGHPCTAADPDSCFTPVSPQHFIDLFKF 1C1C6AD43A92754F fbxo25-cand1 2 8 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait n terminal gst/ha tandem tag tandem tag n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain c terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-3454362]Start status c-terminal and end status certain are inconsistent [EBI-3454362]367-367 f domain required to bind necessary binding region required to bind range range range range 6 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey association association 2 cul1-fbxo25 4 11 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component colocalization colocalization fig 3 fbxo25-actin 2 12 unspecified role unspecified role bait bait undefined mutation mutation mutation range range range range Wed Jul 06 17:11:43 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'f-box region' n terminal gst/ha tandem tag tandem tag n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain c terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-3454402]Start status c-terminal and end status certain are inconsistent [EBI-3454402]367-367 9 unspecified role unspecified role prey prey physical association physical association fig 4 actb-fbxo25 4 9 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component colocalization colocalization fig 7 fbxo25-actb 3 7 unspecified role unspecified role bait bait delta f-box region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range range range certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role prey prey physical association physical association fig 5 fbxo25-actb-2 5 11 unspecified role unspecified role prey prey 633-645 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 230-242 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 727-741 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 75-90 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 275-289 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 299-315 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 118-127 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 579-587 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 247-262 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 339-354 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 377-397 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 507-515 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 365-375 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 436-454 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 118-127 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 14-25 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 26-34 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 455-464 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 106-117 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 474-491 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 74-90 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey 95-113 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 6-22 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 81-94 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 82-94 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey 1179-1191 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 535-548 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 535-548 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 730-743 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 668-679 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 991-1005 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 1014-1023 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 813-826 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role bait bait n terminal gst/ha tandem tag tandem tag n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain c terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-3454541]Start status c-terminal and end status certain are inconsistent [EBI-3454541]367-367 68-79 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 80-87 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 123-135 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 43-53 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 263-290 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role prey prey 96-113 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 360-372 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 197-206 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 292-312 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 148-177 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 291-312 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 292-312 identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain association association fbxo25-actb 1 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait delta f-box region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain certain certain sequence position certain range range physical association physical association fig 5 and 6 fbxo25-cand1-1 2 6 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait n terminal gst/ha tandem tag tandem tag n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain c terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation mutation range range range range Wed Jul 06 16:35:10 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'f domain' association association 2 fbxo25-actb-3 3 7 unspecified role unspecified role bait bait delta f-box region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range range range certain certain sequence position certain 9 unspecified role unspecified role prey prey n terminus required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association fig 6