UniProt UniProt http://www.uniprot.org Selective export of human GPI-anchored proteins from the endoplasmic reticulum. Selective export of human GPI-anchored proteins from the endoplasmic reticulum. J. Cell. Sci. (0021-9533) 2010 mimix curation Bonnon C., Wendeler M.W., Paccaud J.P., Hauri H.P. Origin of myc-p23 from pmid 10683152. Origin of HA-p24 from pmid 10852829. Experiments with CD59-GFP not included as origin cannot be established from cited pmid 11331304 (fig 3c and d). Experiments with folate receptor not included as origin cannot be established from pmid 15557121 (fig. 4) hans-peter.hauri@inibas.ch 21-Dec-2011: Contacted by JYOTI. human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Bonnon C., Wendeler M.W., Paccaud J.P., Hauri H.P. Origin of myc-p23 from pmid 10683152. Origin of HA-p24 from pmid 10852829. Experiments with CD59-GFP not included as origin cannot be established from cited pmid 11331304 (fig 3c and d). Experiments with folate receptor not included as origin cannot be established from pmid 15557121 (fig. 4) hans-peter.hauri@inibas.ch Accepted 2011-SEP-21 by JYOTI 21-Dec-2011: Contacted by JYOTI. J. Cell. Sci. (0021-9533) 2010 mimix curation Selective export of human GPI-anchored proteins from the endoplasmic reticulum. Selective export of human GPI-anchored proteins from the endoplasmic reticulum. J. Cell. Sci. (0021-9533) 2010 mimix curation Bonnon C., Wendeler M.W., Paccaud J.P., Hauri H.P. Origin of myc-p23 from pmid 10683152. Origin of HA-p24 from pmid 10852829. Experiments with CD59-GFP not included as origin cannot be established from cited pmid 11331304 (fig 3c and d). Experiments with folate receptor not included as origin cannot be established from pmid 15557121 (fig. 4) hans-peter.hauri@inibas.ch 21-Dec-2011: Contacted by JYOTI. human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bonnon C., Wendeler M.W., Paccaud J.P., Hauri H.P. Origin of myc-p23 from pmid 10683152. Origin of HA-p24 from pmid 10852829. Experiments with CD59-GFP not included as origin cannot be established from cited pmid 11331304 (fig 3c and d). Experiments with folate receptor not included as origin cannot be established from pmid 15557121 (fig. 4) hans-peter.hauri@inibas.ch Accepted 2011-SEP-21 by JYOTI 21-Dec-2011: Contacted by JYOTI. J. Cell. Sci. (0021-9533) 2010 mimix curation Selective export of human GPI-anchored proteins from the endoplasmic reticulum. Selective export of human GPI-anchored proteins from the endoplasmic reticulum. J. Cell. Sci. (0021-9533) 2010 mimix curation Bonnon C., Wendeler M.W., Paccaud J.P., Hauri H.P. Origin of myc-p23 from pmid 10683152. Origin of HA-p24 from pmid 10852829. Experiments with CD59-GFP not included as origin cannot be established from cited pmid 11331304 (fig 3c and d). Experiments with folate receptor not included as origin cannot be established from pmid 15557121 (fig. 4) hans-peter.hauri@inibas.ch 21-Dec-2011: Contacted by JYOTI. human Homo sapiens Human density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Bonnon C., Wendeler M.W., Paccaud J.P., Hauri H.P. Origin of myc-p23 from pmid 10683152. Origin of HA-p24 from pmid 10852829. Experiments with CD59-GFP not included as origin cannot be established from cited pmid 11331304 (fig 3c and d). Experiments with folate receptor not included as origin cannot be established from pmid 15557121 (fig. 4) hans-peter.hauri@inibas.ch Accepted 2011-SEP-21 by JYOTI 21-Dec-2011: Contacted by JYOTI. J. Cell. Sci. (0021-9533) 2010 mimix curation Selective export of human GPI-anchored proteins from the endoplasmic reticulum. Selective export of human GPI-anchored proteins from the endoplasmic reticulum. J. Cell. Sci. (0021-9533) 2010 mimix curation Bonnon C., Wendeler M.W., Paccaud J.P., Hauri H.P. Origin of myc-p23 from pmid 10683152. Origin of HA-p24 from pmid 10852829. Experiments with CD59-GFP not included as origin cannot be established from cited pmid 11331304 (fig 3c and d). Experiments with folate receptor not included as origin cannot be established from pmid 15557121 (fig. 4) hans-peter.hauri@inibas.ch 21-Dec-2011: Contacted by JYOTI. human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Bonnon C., Wendeler M.W., Paccaud J.P., Hauri H.P. Origin of myc-p23 from pmid 10683152. Origin of HA-p24 from pmid 10852829. Experiments with CD59-GFP not included as origin cannot be established from cited pmid 11331304 (fig 3c and d). Experiments with folate receptor not included as origin cannot be established from pmid 15557121 (fig. 4) hans-peter.hauri@inibas.ch Accepted 2011-SEP-21 by JYOTI 21-Dec-2011: Contacted by JYOTI. J. Cell. Sci. (0021-9533) 2010 mimix curation Selective export of human GPI-anchored proteins from the endoplasmic reticulum. Selective export of human GPI-anchored proteins from the endoplasmic reticulum. J. Cell. Sci. (0021-9533) 2010 mimix curation Bonnon C., Wendeler M.W., Paccaud J.P., Hauri H.P. Origin of myc-p23 from pmid 10683152. Origin of HA-p24 from pmid 10852829. Experiments with CD59-GFP not included as origin cannot be established from cited pmid 11331304 (fig 3c and d). Experiments with folate receptor not included as origin cannot be established from pmid 15557121 (fig. 4) hans-peter.hauri@inibas.ch 21-Dec-2011: Contacted by JYOTI. human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Bonnon C., Wendeler M.W., Paccaud J.P., Hauri H.P. Origin of myc-p23 from pmid 10683152. Origin of HA-p24 from pmid 10852829. Experiments with CD59-GFP not included as origin cannot be established from cited pmid 11331304 (fig 3c and d). Experiments with folate receptor not included as origin cannot be established from pmid 15557121 (fig. 4) hans-peter.hauri@inibas.ch Accepted 2011-SEP-21 by JYOTI J. Cell. Sci. (0021-9533) 2010 mimix curation tmed2_human Transmembrane emp24 domain-containing protein 2 TMED2 RNP24 Membrane protein p24A p24 family protein beta-1 p24 protein protein human Homo sapiens Human MVTLAELLVLLAALLATVSGYFVSIDAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVEITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQDMETEAHQNKLEEMINELAVAMTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVLVAMTLGQIYYLKRFFEVRRVV C452370E459DC894 cd59_human CD59 glycoprotein CD59 Membrane attack complex inhibition factor MAC-inhibitory protein Protectin MEM43 antigen Membrane inhibitor of reactive lysis 20 kDa homologous restriction factor 1F5 antigen MIC11 MIN1 MIN2 MIN3 MSK21 protein protein human Homo sapiens Human MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP 2F0D29CBE3C28505 sc24c_human Protein transport protein Sec24C SEC24C KIAA0079 SEC24-related protein C protein protein human Homo sapiens Human MNVNQSVPPVPPFGQPQPIYPGYHQSSYGGQSGSTAPAIPYGAYNGPVPGYQQTPPQGMSRAPPSSGAPPASTAQAPCGQAAYGQFGQGDVQNGPSSTVQMQRLPGSQPFGSPLAPVGNQPPVLQPYGPPPTSAQVATQLSGMQISGAVAPAPPSSGLGFGPPTSLASASGSFPNSGLYGSYPQGQAPPLSQAQGHPGIQTPQRSAPSQASSFTPPASGGPRLPSMTGPLLPGQSFGGPSVSQPNHVSSPPQALPPGTQMTGPLGPLPPMHSPQQPGYQPQQNGSFGPARGPQSNYGGPYPAAPTFGSQPGPPQPLPPKRLDPDAIPSPIQVIEDDRNNRGTEPFVTGVRGQVPPLVTTNFLVKDQGNASPRYIRCTSYNIPCTSDMAKQAQVPLAAVIKPLARLPPEEASPYVVDHGESGPLRCNRCKAYMCPFMQFIEGGRRFQCCFCSCINDVPPQYFQHLDHTGKRVDAYDRPELSLGSYEFLATVDYCKNNKFPSPPAFIFMIDVSYNAIRTGLVRLLCEELKSLLDFLPREGGAEESAIRVGFVTYNKVLHFYNVKSSLAQPQMMVVSDVADMFVPLLDGFLVNVNESRAVITSLLDQIPEMFADTRETETVFVPVIQAGMEALKAAECAGKLFLFHTSLPIAEAPGKLKNRDDRKLINTDKEKTLFQPQTGAYQTLAKECVAQGCCVDLFLFPNQYVDVATLSVVPQLTGGSVYKYASFQVENDQERFLSDLRRDVQKVVGFDAVMRVRTSTGIRAVDFFGAFYMSNTTDVELAGLDGDKTVTVEFKHDDRLNEESGALLQCALLYTSCAGQRRLRIHNLALNCCTQLADLYRNCETDTLINYMAKFAYRGVLNSPVKAVRDTLITQCAQILACYRKNCASPSSAGQLILPECMKLLPVYLNCVLKSDVLQPGAEVTTDDRAYVRQLVTSMDVTETNVFFYPRLLPLTKSPVESTTEPPAVRASEERLSNGDIYLLENGLNLFLWVGASVQQGVVQSLFSVSSFSQITSGLSVLPVLDNPLSKKVRGLIDSLRAQRSRYMKLTVVKQEDKMEMLFKHFLVEDKSLSGGASYVDFLCHMHKEIRQLLS DIP protein P53992 original sequence version: 104 5E308E4B8E596ECE tmeda_mesau Transmembrane emp24 domain-containing protein 10 TMED10 TMP21 21 kDa transmembrane-trafficking protein Integral membrane protein p23 p24 family protein delta-1 Transmembrane protein Tmp21 protein protein mesau Mesocricetus auratus (Golden hamster) Golden hamster MSGSSGPLSWPGPRPCALLFLLLLGPSSVLAISFHLPVNSRKCLREEIHKDLLVTGAYEITDQSGGAGGLRTHLKITDSAGHILYAKEDATKGKFAFTTEDYDMFEVCFESKGTGRIPDQLVILDMKHGVEAKNYEEIAKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIFSMLCLIGLATWQVFYLRRFFKAKKLIE 1FCF2E49ABB565EB cav1_human Caveolin-1 CAV1 CAV protein protein human Homo sapiens Human MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI DIP protein Q03135 original sequence version: 164 DIP protein Q03135 original sequence version: 119 DIP protein Q03135 original sequence version: 122 DIP protein Q03135-1 original sequence version: 122 DIP protein Q03135 original sequence version: 133 DIP protein Q03135 original sequence version: 155 DIP protein Q03135 original sequence version: 147 2424DE9B5E6521D5 sc24d_human Protein transport protein Sec24D KIAA0755 SEC24D SEC24-related protein D protein protein human Homo sapiens Human MSQQGYVATPPYSQPQPGIGLSPPHYGHYGDPSHTASPTGMMKPAGPLGATATRGMLPPGPPPPGPHQFGQNGAHATGHPPQRFPGPPPVNNVASSHAPYQPSAQSSYPGPISTSSVTQLGSQLSAMQINSYGSGMAPPSQGPPGPLSATSLQTPPRPPQPSILQPGSQVLPPPPTTLNGPGASPLPLPMYRPDGLSGPPPPNAQYQPPPLPGQTLGAGYPPQQANSGPQMAGAQLSYPGGFPGGPAQMAGPPQPQKKLDPDSIPSPIQVIENDRASRGGQVYATNTRGQIPPLVTTDCMIQDQGNASPRFIRCTTYCFPCTSDMAKQAQIPLAAVIKPFATIPSNESPLYLVNHGESGPVRCNRCKAYMCPFMQFIEGGRRYQCGFCNCVNDVPPFYFQHLDHIGRRLDHYEKPELSLGSYEYVATLDYCRKSKPPNPPAFIFMIDVSYSNIKNGLVKLICEELKTMLEKIPKEEQEETSAIRVGFITYNKVLHFFNVKSNLAQPQMMVVTDVGEVFVPLLDGFLVNYQESQSVIHNLLDQIPDMFADSNENETVFAPVIQAGMEALKAADCPGKLFIFHSSLPTAEAPGKLKNRDDKKLVNTDKEKILFQPQTNVYDSLAKDCVAHGCSVTLFLFPSQYVDVASLGLVPQLTGGTLYKYNNFQMHLDRQQFLNDLRNDIEKKIGFDAIMRVRTSTGFRATDFFGGILMNNTTDVEMAAIDCDKAVTVEFKHDDKLSEDSGALIQCAVLYTTISGQRRLRIHNLGLNCSSQLADLYKSCETDALINFFAKSAFKAVLHQPLKVIREILVNQTAHMLACYRKNCASPSAASQLILPDSMKVLPVYMNCLLKNCVLLSRPEISTDERAYQRQLVMTMGVADSQLFFYPQLLPIHTLDVKSTMLPAAVRCSESRLSEEGIFLLANGLHMFLWLGVSSPPELIQGIFNVPSFAHINTDMTLLPEVGNPYSQQLRMIMGIIQQKRPYSMKLTIVKQREQPEMVFRQFLVEDKGLYGGSSYVDFLCCVHKEICQLLN B46E566F096F37F0 sc24a_human Protein transport protein Sec24A SEC24-related protein A SEC24A protein protein human Homo sapiens Human MSQPGIPASGGAPASLQAQNGAALASGSPYTNGPVQNALLSSQESVSQGYNFQLPGSYPHPIPAKTLNPVSGQSNYGGSQGSGQTLNRPPVASNPVTPSLHSGPAPRMPLPASQNPATTPMPSSSFLPEANLPPPLNWQYNYPSTASQTNHCPRASSQPTVSGNTSLTTNHQYVSSGYPSLQNSFIKSGPSVPPLVNPPLPTTFQPGAPHGPPPAGGPPPVRALTPLTSSYRDVPQPLFNSAVNQEGITSNTNNGSMVVHSSYDEIEGGGLLATPQLTNKNPKMSRSVGYSYPSLPPGYQNTTPPGATGVPPSSLNYPSGPQAFTQTPLGANHLTTSMSGLSLQPEGLRVVNLLQERNMLPSTPLKPPVPNLHEDIQKLNCNPELFRCTLTSIPQTQALLNKAKLPLGLLLHPFKDLVQLPVVTSSTIVRCRSCRTYINPFVSFLDQRRWKCNLCYRVNDVPEEFLYNPLTRVYGEPHRRPEVQNATIEFMAPSEYMLRPPQPPVYLFVFDVSHNAVETGYLNSVCQSLLDNLDLLPGNTRTKIGFITFDSTIHFYGLQESLSQPQMLIVSDIEDVFIPMPENLLVNLNESKELVQDLLKTLPQMFTKTLETQSALGPALQAAFKLMSPTGGRMSVFQTQLPTLGVGALKPREEPNHRSSAKDIHMTPSTDFYKKLALDCSGQQVAVDLFLLSGQYSDLASLGCISRYSAGSVYYYPSYHHQHNPVQVQKLQKELQRYLTRKIGFEAVMRIRCTKGLSIHTFHGNFFVRSTDLLSLPNVNPDAGYAVQMSVEESLTDTQLVSFQSALLYTSSKGERRIRVHTLCLPVVSTLNDVFLGADVQAISGLLANMAVDRSMTASLSDARDALVNAVIDSLSAYRSSVLSNQQPGLMVPFSLRLFPLFVLALLKQKSFQTGTNARLDERIFAMCQVKNQPLVYLMLTTHPSLYRVDNLSDEGALNISDRTIPQPPILQLSVEKLSRDGAFLMDAGSVLMLWVGKNCTQNFLSQVLGVQNYASIPQPMTDLPELDTPESARIIAFISWLREQRPFFPILYVIRDESPMKANFLQNMIEDRTESALSYYEFLLHIQQQVNK E21F3A1333674A6A sc24b_human Protein transport protein Sec24B SEC24B SEC24-related protein B protein protein human Homo sapiens Human MSAPAGSSHPAASARIPPKFGGAAVSGAAAPAGPGAGPAPHQQNGPAQNQMQVPSGYGLHHQNYIAPSGHYSQGPGKMTSLPLDTQCGDYYSALYTVPTQNVTPNTVNQQPGAQQLYSRGPPAPHIVGSTLGSFQGAASSASHLHTSASQPYSSFVNHYNSPAMYSASSSVASQGFPSTCGHYAMSTVSNAAYPSVSYPSLPAGDTYGQMFTSQNAPTVRPVKDNSFSGQNTAISHPSPLPPLPSQQHHQQQSLSGYSTLTWSSPGLPSTQDNLIRNHTGSLAVANNNPTITVADSLSCPVMQNVQPPKSSPVVSTVLSGSSGSSSTRTPPTANHPVEPVTSVTQPSELLQQKGVQYGEYVNNQASSAPTPLSSTSDDEEEEEEDEEAGVDSSSTTSSASPMPNSYDALEGGSYPDMLSSSASSPAPDPAPEPDPASAPAPASAPAPVVPQPSKMAKPFGYGYPTLQPGYQNATAPLISGVQPSNPVYSGFQQYPQQYPGVNQLSSSIGGLSLQSSPQPESLRPVNLTQERNILPMTPVWAPVPNLNADLKKLNCSPDSFRCTLTNIPQTQALLNKAKLPLGLLLHPFRDLTQLPVITSNTIVRCRSCRTYINPFVSFIDQRRWKCNLCYRVNDVPEEFMYNPLTRSYGEPHKRPEVQNSTVEFIASSDYMLRPPQPAVYLFVLDVSHNAVEAGYLTILCQSLLENLDKLPGDSRTRIGFMTFDSTIHFYNLQEGLSQPQMLIVSDIDDVFLPTPDSLLVNLYESKELIKDLLNALPNMFTNTRETHSALGPALQAAFKLMSPTGGRVSVFQTQLPSLGAGLLQSREDPNQRSSTKVVQHLGPATDFYKKLALDCSGQQTAVDLFLLSSQYSDLASLACMSKYSAGCIYYYPSFHYTHNPSQAEKLQKDLKRYLTRKIGFEAVMRIRCTKGLSMHTFHGNFFVRSTDLLSLANINPDAGFAVQLSIEESLTDTSLVCFQTALLYTSSKGERRIRVHTLCLPVVSSLADVYAGVDVQAAICLLANMAVDRSVSSSLSDARDALVNAVVDSLSAYGSTVSNLQHSALMAPSSLKLFPLYVLALLKQKAFRTGTSTRLDDRVYAMCQIKSQPLVHLMKMIHPNLYRIDRLTDEGAVHVNDRIVPQPPLQKLSAEKLTREGAFLMDCGSVFYIWVGKGCDNNFIEDVLGYTNFASIPQKMTHLPELDTLSSERARSFITWLRDSRPLSPILHIVKDESPAKAEFFQHLIEDRTEAAFSYYEFLLHVQQQICK 0E08B982D0982F84 tmeda_human Transmembrane emp24 domain-containing protein 10 21 kDa transmembrane-trafficking protein Transmembrane protein Tmp21 Tmp-21-I p24delta S31III125 TMED10 TMP21 p23 p24 family protein delta-1 S31I125 protein protein human Homo sapiens Human MSGLSGPPARRGPFPLALLLLFLLGPRLVLAISFHLPINSRKCLREEIHKDLLVTGAYEISDQSGGAGGLRSHLKITDSAGHILYSKEDATKGKFAFTTEDYDMFEVCFESKGTGRIPDQLVILDMKHGVEAKNYEEIAKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIFSMFCLIGLATWQVFYLRRFFKAKKLIE 0A0486BE65C4DBBB cd59-tmed10 5 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association 3a and 6b tmed10-cd59 2 9 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 3b tmed10-cd59-1 1 9 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 3e tmed2-cd59 1 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 3f and 6e cd59-tmed10-1 4 7 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 3e cd59-tmed2 4 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 3f cav1-cd59-1 3 6 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component colocalization colocalization 6a and 7a Disrupted by cholesterol depletion cd59-tmed2-1 5 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 6c cd59-tmed10-2 3 9 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component colocalization colocalization 6d tmed10-sec24b 2 9 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association 5i tmed10-sec24b-1 2 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 5i tmed10-sec24c 2 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 5i tmed2-sec24a 2 12 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 5j tmed2-sec24b 2 6 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association 5j tmed2-sec24c 2 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 5j tmed2-sec24d 2 6 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association 5j tmed2-tmed10-2 5 6 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association S4a tmed10-tmed2-6 2 6 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association S4a tmed2-tmed10-3 2 6 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association S4b