UniProt UniProt http://www.uniprot.org Visualizing interactions along the Escherichia coli twin-arginine translocation pathway using protein fragment complementation. Visualizing interactions along the Escherichia coli twin-arginine translocation pathway using protein fragment complementation. PLoS ONE (null) 2010 imex curation Kostecki J.S., Li H., Turner R.J., DeLisa M.P. again they've also done these expts with whole DmsA, and fig S2b also shows the 2 proteins associate because they fluoresce, do I annotate all that too? - I think the identification is too vague, so you can leave that one. signal sequence of dmsA excluding the signal peptide cleavage site is assumed to be 1-44. md255@cornell.edu 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions ecoli Escherichia coli (strain K12) bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Kostecki J.S., Li H., Turner R.J., DeLisa M.P. again they've also done these expts with whole DmsA, and fig S2b also shows the 2 proteins associate because they fluoresce, do I annotate all that too? - I think the identification is too vague, so you can leave that one. again they've also done these expts with whole DmsA, and fig S2b also shows the 2 proteins associate because they fluoresce, do I annotate all that too? - I think the identification is too vague, so you can leave that one. signal sequence of dmsA excluding the signal peptide cleavage site is assumed to be 1-44. md255@cornell.edu Accepted 2011-NOV-25 by ORCHARD PLoS ONE (null) 2010 Only protein-protein interactions imex curation Visualizing interactions along the Escherichia coli twin-arginine translocation pathway using protein fragment complementation. Visualizing interactions along the Escherichia coli twin-arginine translocation pathway using protein fragment complementation. PLoS ONE (null) 2010 imex curation Kostecki J.S., Li H., Turner R.J., DeLisa M.P. again they've also done these expts with whole DmsA, and fig S2b also shows the 2 proteins associate because they fluoresce, do I annotate all that too? - I think the identification is too vague, so you can leave that one. signal sequence of dmsA excluding the signal peptide cleavage site is assumed to be 1-44. md255@cornell.edu 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions ecoli Escherichia coli (strain K12) pull down pull down anti tag western anti tag western blot anti tag western Kostecki J.S., Li H., Turner R.J., DeLisa M.P. again they've also done these expts with whole DmsA, and fig S2b also shows the 2 proteins associate because they fluoresce, do I annotate all that too? - I think the identification is too vague, so you can leave that one. signal sequence of dmsA excluding the signal peptide cleavage site is assumed to be 1-44. md255@cornell.edu Accepted 2011-NOV-25 by ORCHARD 14-Mar-2012: Contacted by JYOTI. PLoS ONE (null) 2010 Only protein-protein interactions imex curation tatc_ecoli Sec-independent protein translocase protein TatC tatC mttB yigU yigV b3839 JW3815 protein protein ecoli Escherichia coli (strain K12) MSVEDTQPLITHLIELRKRLLNCIIAVIVIFLCLVYFANDIYHLVSAPLIKQLPQGSTMIATDVASPFFTPIKLTFMVSLILSAPVILYQVWAFIAPALYKHERRLVVPLLVSSSLLFYIGMAFAYFVVFPLAFGFLANTAPEGVQVSTDIASYLSFVMALFMAFGVSFEVPVAIVLLCWMGITSPEDLRKKRPYVLVGAFVVGMLLTPPDVFSQTLLAIPMYCLFEIGVFFSRFYVGKGRNREEENDAEAESEKTEE DIP protein P69423 original sequence version: 49 D2383F85AF62A81C tatb_ecoli Sec-independent protein translocase protein TatB tatB mttA2 ysgB b3838 JW5580 protein protein ecoli Escherichia coli (strain K12) MFDIGFSELLLVFIIGLVVLGPQRLPVAVKTVAGWIRALRSLATTVQNELTQELKLQEFQDSLKKVEKASLTNLTPELKASMDELRQAAESMKRSYVANDPEKASDEAHTIHNPVVKDNEAAHEGVTPAAAQTQASSPEQKPETTPEPVVKPAADAEPKTAAPSPSSSDKP DIP protein P69425 original sequence version: 44 31F1405404F5DABF tata_ecoli Sec-independent protein translocase protein TatA tatA mttA1 yigT b3836 JW3813 protein protein ecoli Escherichia coli (strain K12) MGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQAKTEDAKRHDKEQV 4874F393EFFADC1B dmsa_ecoli Dimethyl sulfoxide reductase DmsA dmsA b0894 JW5118 protein protein ecoli Escherichia coli (strain K12) MKTKIPDAVLAAEVSRRGLVKTTAIGGLAMASSALTLPFSRIAHAVDSAIPTKSDEKVIWSACTVNCGSRCPLRMHVVDGEIKYVETDNTGDDNYDGLHQVRACLRGRSMRRRVYNPDRLKYPMKRVGARGEGKFERISWEEAYDIIATNMQRLIKEYGNESIYLNYGTGTLGGTMTRSWPPGNTLVARLMNCCGGYLNHYGDYSSAQIAEGLNYTYGGWADGNSPSDIENSKLVVLFGNNPGETRMSGGGVTYYLEQARQKSNARMIIIDPRYTDTGAGREDEWIPIRPGTDAALVNGLAYVMITENLVDQAFLDKYCVGYDEKTLPASAPKNGHYKAYILGEGPDGVAKTPEWASQITGVPADKIIKLAREIGSTKPAFISQGWGPQRHANGEIATRAISMLAILTGNVGINGGNSGAREGSYSLPFVRMPTLENPIQTSISMFMWTDAIERGPEMTALRDGVRGKDKLDVPIKMIWNYAGNCLINQHSEINRTHEILQDDKKCELIVVIDCHMTSSAKYADILLPDCTASEQMDFALDASCGNMSYVIFNDQVIKPRFECKTIYEMTSELAKRLGVEQQFTEGRTQEEWMRHLYAQSREAIPELPTFEEFRKQGIFKKRDPQGHHVAYKAFREDPQANPLTTPSGKIEIYSQALADIAATWELPEGDVIDPLPIYTPGFESYQDPLNKQYPLQLTGFHYKSRVHSTYGNVDVLKAACRQEMWINPLDAQKRGIHNGDKVRIFNDRGEVHIEAKVTPRMMPGVVALGEGAWYDPDAKRVDKGGCINVLTTQRPSPLAKGNPSHTNLVQVEKV DIP protein P18775 original sequence version: 96 B97C830ABAC7C32C dmsd_ecoli Tat proofreading chaperone DmsD dmsD ynfI b1591 JW5262 DMSO reductase maturation protein Twin-arginine leader-binding protein DmsD protein protein ecoli Escherichia coli (strain K12) MTHFSQQDNFSVAARVLGALFYYAPESAEAAPLVAVLTSDGWETQWPLPEASLAPLVTAFQTQCEETHAQAWQRLFVGPWALPSPPWGSVWLDRESVLFGDSTLALRQWMREKGIQFEMKQNEPEDHFGSLLLMAAWLAENGRQTECEELLAWHLFPWSTRFLDVFIEKAEHPFYRALGELARLTLAQWQSQLLIPVAVKPLFR DIP protein P69853 original sequence version: 43 CB4273F4B6539D47 dmsa-dmsd-1 1 6 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P69853:p.[Trp72His;Leu75Tyr] mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain L Y certain certain sequence position certain certain certain sequence position certain W H Fri Jul 22 10:54:53 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'leu75tyr,trp72his' Wed May 02 17:37:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp72his,leu75tyr' Tue Jun 30 16:34:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp72His;Leu75Tyr]' physical association physical association Fig 2A,B, Fig 3A, Fig S3, Table 1 Added only 1 mutagenesis expt, the one that showed most gain in binding to ssDmsA construct is signal seq of DmsA, then Y1 fragment of YFP, then FLAG, how do you indicate in which order they are found? dmsd-dmsa-1 2 7 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig S2c, S2d tata-tata-1 1 5 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal ecoli Escherichia coli (strain K12) physical association physical association Fig 4A, B tatb-tatb-1 1 4 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association fig 5a tata-tatb-1 1 5 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal 4 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal physical association physical association Fig 5A tata-tatc-1 1 3 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal ecoli Escherichia coli (strain K12) physical association physical association Fig 5A the opposite construction has also been made, TatC-Y1-FLAG + TatA-Y2, but is very hard to annotate tatb-tatc-1 1 4 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal ecoli Escherichia coli (strain K12) physical association physical association Fig 5A, B, C Again the opposite expt has been done, TatC-Y1-FLAG + TatB-Y2, but it is hard to annotate tatb-tatc-2 1 3 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal ecoli Escherichia coli (strain K12) physical association physical association Fig 5B, C Again the opposite expt has been done, TatC-Y1-FLAG + TatB-Y2, but it is hard to annotate dmsa-tatb-1 1 4 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component P18775:p.[Arg16Lys;Arg17Lys] mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain R K certain certain sequence position certain certain certain sequence position certain R K Wed May 02 14:41:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg16lys,arg17lys' Tue Jun 30 16:01:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg16Lys;Arg17Lys]' region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig 6A dmsa-tatc-2 1 3 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal P69423:p.Glu103Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain E R Wed May 02 16:12:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu103arg' Tue Jun 30 19:38:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu103Arg' P69423:p.Pro48Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Wed May 02 15:37:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro48ala' Tue Jun 30 20:25:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro48Ala' ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P18775:p.[Arg16Lys;Arg17Lys] mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain R K certain certain sequence position certain certain certain sequence position certain R K Wed May 02 20:28:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg16lys,arg17lys' Tue Jun 30 16:40:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg16Lys;Arg17Lys]' ecoli Escherichia coli (strain K12) physical association physical association Fig 6A expt supposedly confirmed by Western blotting in Fig S4, but the lanes are not fully labelled and I don't know which are soluble and which are membrane tatb-dmsd 1 7 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal ecoli Escherichia coli (strain K12) physical association physical association Fig 6B tatc-dmsd 1 3 unspecified role unspecified role neutral component neutral component P69423:p.Glu103Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain E R Wed May 02 18:28:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu103arg' Tue Jun 30 20:26:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu103Arg' region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal P69423:p.Pro48Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Wed May 02 16:00:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro48ala' Tue Jun 30 19:49:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro48Ala' ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal ecoli Escherichia coli (strain K12) physical association physical association Fig 6B TatC E103R has slightly different phenotypes depending on constructs