MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Wild-type p53-induced phosphatase 1 dephosphorylates histone variant gamma-H2AX and suppresses DNA double strand break repair. Wild-type p53-induced phosphatase 1 dephosphorylates histone variant gamma-H2AX and suppresses DNA double strand break repair. J. Biol. Chem. (0021-9258) 2010 rapid curation Moon SH., Lin L., Zhang X., Nguyen TA., Darlington Y., Waldman AS., Lu X., Donehower LA. 30-Sept-2013: Contacted by IntAct-Help. partial coverage rapid curation human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Moon SH., Lin L., Zhang X., Nguyen TA., Darlington Y., Waldman AS., Lu X., Donehower LA. Accepted 2013-SEP-06 by MARTA 30-Sept-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2010 partial coverage rapid curation rapid curation Wild-type p53-induced phosphatase 1 dephosphorylates histone variant gamma-H2AX and suppresses DNA double strand break repair. Wild-type p53-induced phosphatase 1 dephosphorylates histone variant gamma-H2AX and suppresses DNA double strand break repair. J. Biol. Chem. (0021-9258) 2010 rapid curation Moon SH., Lin L., Zhang X., Nguyen TA., Darlington Y., Waldman AS., Lu X., Donehower LA. 30-Sept-2013: Contacted by IntAct-Help. partial coverage rapid curation in vitro In vitro phosphatase assay phosphatase assay predetermined predetermined participant predetermined Moon SH., Lin L., Zhang X., Nguyen TA., Darlington Y., Waldman AS., Lu X., Donehower LA. Accepted 2013-SEP-06 by MARTA 30-Sept-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2010 partial coverage rapid curation rapid curation h2ax_human Histone H2AX H2AX H2AFX Histone H2A.X protein protein human Homo sapiens Human MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY DIP protein P16104 original sequence version: 114 DIP protein P16104 original sequence version: 110 DIP protein P16104 original sequence version: 117 DIP protein P16104 original sequence version: 133 DIP protein P16104 original sequence version: 140 DIP protein P16104 original sequence version: 113 DIP protein P16104 original sequence version: 99 D4683775C2E6C3A9 ppm1d_human Protein phosphatase 1D Protein phosphatase 2C isoform delta p53-induced protein phosphatase 1 Protein phosphatase magnesium-dependent 1 delta PPM1D WIP1 protein protein human Homo sapiens Human MAGLYSLGVSVFSDQGGRKYMEDVTQIVVEPEPTAEEKPSPRRSLSQPLPPRPSPAALPGGEVSGKGPAVAAREARDPLPDAGASPAPSRCCRRRSSVAFFAVCDGHGGREAAQFAREHLWGFIKKQKGFTSSEPAKVCAAIRKGFLACHLAMWKKLAEWPKTMTGLPSTSGTTASVVIIRGMKMYVAHVGDSGVVLGIQDDPKDDFVRAVEVTQDHKPELPKERERIEGLGGSVMNKSGVNRVVWKRPRLTHNGPVRRSTVIDQIPFLAVARALGDLWSYDFFSGEFVVSPEPDTSVHTLDPQKHKYIILGSDGLWNMIPPQDAISMCQDQEEKKYLMGEHGQSCAKMLVNRALGRWRQRMLRADNTSAIVICISPEVDNQGNFTNEDELYLNLTDSPSYNSQETCVMTPSPCSTPPVKSLEEDPWPRVNSKDHIPALVRSNAFSENFLEVSAEIARENVQGVVIPSKDPEPLEENCAKALTLRIHDSLNNSLPIGLVPTNSTNTVMDQKNLKMSTPGQMKAQEIERTPPTNFKRTLEESNSGPLMKKHRRNGLSRSSGAQPASLPTTSQRKNSVKLTMRRRLRGQKKIGNPLLHQHRKTVCVC DIP protein O15297 original sequence version: 119 E6C5884CF04008B7 h2afx-ppm1d 2 H2A.x 3 enzyme target enzyme target substrate substrate neutral component neutral component phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Resulting Phenotypic qualities (properties)[PATO]: PATO:0002263 (dephosphorylated) WIP1 4 enzyme enzyme neutral component neutral component dephosphorylation dephosphorylation reaction dephosphorylation f1 homomint mint ppm1d-h2afx 1 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association f2d homomint mint h2afx-ppm1d-4 1 3 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association f2d homomint mint