UniProt UniProt http://www.uniprot.org Structural basis for the interaction between yeast Spt-Ada-Gcn5 acetyltransferase (SAGA) complex components Sgf11 and Sus1. Structural basis for the interaction between yeast Spt-Ada-Gcn5 acetyltransferase (SAGA) complex components Sgf11 and Sus1. J. Biol. Chem. (0021-9258) 2010 imex curation Ellisdon AM., Jani D., Kohler A., Hurt E., Stewart M. ms@mrc-lmb.cam.ac.uk orchard Only protein-protein interactions in vitro In vitro pull down pull down weight by staining molecular weight estimation by staining weight by staining Ellisdon AM., Jani D., Kohler A., Hurt E., Stewart M. ms@mrc-lmb.cam.ac.uk Accepted 2011-MAR-04 by ORCHARD J. Biol. Chem. (0021-9258) 2010 orchard Only protein-protein interactions imex curation Structural basis for the interaction between yeast Spt-Ada-Gcn5 acetyltransferase (SAGA) complex components Sgf11 and Sus1. Structural basis for the interaction between yeast Spt-Ada-Gcn5 acetyltransferase (SAGA) complex components Sgf11 and Sus1. J. Biol. Chem. (0021-9258) 2010 imex curation Ellisdon AM., Jani D., Kohler A., Hurt E., Stewart M. ms@mrc-lmb.cam.ac.uk orchard Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ellisdon AM., Jani D., Kohler A., Hurt E., Stewart M. ms@mrc-lmb.cam.ac.uk Accepted 2011-MAR-04 by ORCHARD J. Biol. Chem. (0021-9258) 2010 orchard Only protein-protein interactions imex curation Structural basis for the interaction between yeast Spt-Ada-Gcn5 acetyltransferase (SAGA) complex components Sgf11 and Sus1. Structural basis for the interaction between yeast Spt-Ada-Gcn5 acetyltransferase (SAGA) complex components Sgf11 and Sus1. J. Biol. Chem. (0021-9258) 2010 imex curation Ellisdon AM., Jani D., Kohler A., Hurt E., Stewart M. ms@mrc-lmb.cam.ac.uk orchard Only protein-protein interactions ecoli Escherichia coli (strain K12) pull down pull down weight by staining molecular weight estimation by staining weight by staining Ellisdon AM., Jani D., Kohler A., Hurt E., Stewart M. ms@mrc-lmb.cam.ac.uk Accepted 2011-MAR-04 by ORCHARD J. Biol. Chem. (0021-9258) 2010 orchard Only protein-protein interactions imex curation sgf11_yeast SAGA-associated factor 11 SGF11 11 kDa SAGA-associated factor YPL047W protein protein yeast Saccharomyces cerevisiae Baker's yeast MTEETITIDSISNGILNNLLTTLIQDIVARETTQQQLLKTRYPDLRSYYFDPNGSLDINGLQKQQESSQYIHCENCGRDVSANRLAAHLQRCLSRGARR 31CBBD4CAA18F3F9 31CBBD4CAA18F3F9 cdc31_yeast Cell division control protein 31 YOR257W CDC31 DSK1 Nucleoporin CDC31 Nuclear pore protein CDC31 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKNRSSLQSGPLNSELLEEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKREILDLIDEYDSEGRHLMKYDDFYIVMGEKILKRDPLDEIKRAFQLFDDDHTGKISIKNLRRVAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAICTDS 25A546E76E1EF520 25A546E76E1EF520 sus1_yeast Transcription and mRNA export factor SUS1 SUS1 YBR111W-A protein protein yeast Saccharomyces cerevisiae Baker's yeast MTMDTAQLKSQIQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNINESTNFTQILSTVEPKALEMVSDSTRETVLKQIREFLEEIVDTQ DB0DA0C9DC13FB21 DB0DA0C9DC13FB21 sac3_yeast Nuclear mRNA export protein SAC3 SAC3 LEP1 YDR159W YD8358.13 Leucine permease transcriptional regulator protein protein yeast Saccharomyces cerevisiae Baker's yeast MNTSFGSVVPSTNFNFFKGHGNNDNTSANSTVNNSNFFLNSNETKPSKNVFMVHSTSQKKSQQPLQNLSHSPSYTENKPDKKKKYMINDAKTIQLVGPLISSPDNLGFQKRSHKARELPRFLINQEPQLEKRAFVQDPWDKANQEKMISLEESIDDLNELYETLKKMRNTERSIMEEKGLVDKADSAKDLYDAIVFQGTCLDMCPTFERSRRNVEYTVYSYEKNQPNDKKASRTKALKVFARPAAAAAPPLPSDVRPPHILVKTLDYIVDNLLTTLPESEGFLWDRMRSIRQDFTYQNYSGPEAVDCNERIVRIHLLILHIMVKSNVEFSLQQELEQLHKSLITLSEIYDDVRSSGGTCPNEAEFRAYALLSKIRDPQYDENIQRLPKHIFQDKLVQMALCFRRVISNSAYTERGFVKTENCLNFYARFFQLMQSPSLPLLMGFFLQMHLTDIRFYALRALSHTLNKKHKPIPFIYLENMLLFNNRQEIIEFCNYYSIEIINGDAADLKTLQHYSHKLSETQPLKKTYLTCLERRLQKTTYKGLINGGEDNLASSVYVKDPKKDRIPSIADQSFLMENFQNNYNEKLNQNSSVKPQINTSPKRVATRPNHFPFSQESKQLPQISQSHTLSTNPLLTPQVHGDLSEQKQQQIKTVTDGGSPFVFDQSAQNSTVEASKAHMISTTSNGAYDEKLSSEQEEMRKKEEQRIEEEKTQLKKKQENADKQVITEQIANDLVKEVVNSSVISIVKREFSEANYRKDFIDTMTRELYDAFLHERLYLIYMDSRAELKRNSTLKKKFFEKWQASYSQAKKNRILEEKKREEIKLVSHQLGVPGFKKSTCLFRTPYKGNVNSSFMLSSSDKNLIFSPVNDEFNKFATHLTKISKLWRPLEMQSIYYDNLTKKFPSNSLTPANLFIYAKDWTSLSNRWILSKFNLQTAQDSKKFSNNIISSRIICIDDEYEPSDFSDLQLLIFNTGVTNPDIFDLEMKLKDDGEELIKLITGISLNTNICFSLLIIYWESAENTLSESTIKHLLKLNRISKNYSSVIERIDLMNLTEESPHKCLEDKLSEISHSYVYKLTERGKYDKTLRQKRSLAGIHSRSTQLQTTKDIDQKMKKMLEKEKNKYQQQIGERNTYAHLESHIDASPRSKKRKLPILLSTSHSSQFKTPLASRLNTSGSSTSPPLPSHLAMKFRKNSRVTSLHTVLPVSTPSHSNNIPAASFSGNNTTDIQSQQLIENQKSTSVYLNNVSERILGNQEICQTPINPVTPVLDGADQGKEDIPDSILELKILIDSVKKKVNND 0679DB1673DDACEB 0679DB1673DDACEB sgf11-sus1-2 2 4 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) direct interaction direct interaction 2.1 A R-value 0.197 R-free 0.231 sgf11-sus1-1 3 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind protein staining protein staining certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q03067:p.Asn18Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain N A Wed May 02 19:54:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn18ala' Tue Jun 30 17:19:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn18Ala' Q03067:p.Leu19Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain L A Wed May 02 15:23:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu19ala' Tue Jun 30 16:44:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu19Ala' Q03067:p.Ile15Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I A Wed May 02 15:01:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile15ala' Tue Jun 30 18:36:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile15Ala' 6 unspecified role unspecified role prey prey physical association physical association fig 1, fig 5 sac3-cdc31-8 3 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind protein staining protein staining certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey physical association physical association fig 6 sac3-cdc31-7 1 6 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind protein staining protein staining certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association fig 6