UniProt UniProt http://www.uniprot.org Z proteins of New World arenaviruses bind RIG-I and interfere with type I interferon induction. Z proteins of New World arenaviruses bind RIG-I and interfere with type I interferon induction. J. Virol. (0022-538X) 2010 imex curation Fan L., Briese T., Lipkin WI. wil2001@columbia.edu 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip polyclonal western polyclonal antibody western blot polyclonal western Fan L., Briese T., Lipkin WI. wil2001@columbia.edu Accepted 2011-MAR-02 by ORCHARD 06-April-2011: Contacted by JYOTI. J. Virol. (0022-538X) 2010 orchard Only protein-protein interactions imex curation Z proteins of New World arenaviruses bind RIG-I and interfere with type I interferon induction. Z proteins of New World arenaviruses bind RIG-I and interfere with type I interferon induction. J. Virol. (0022-538X) 2010 imex curation Fan L., Briese T., Lipkin WI. wil2001@columbia.edu 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Fan L., Briese T., Lipkin WI. wil2001@columbia.edu Accepted 2011-MAR-02 by ORCHARD 06-April-2011: Contacted by JYOTI. J. Virol. (0022-538X) 2010 orchard Only protein-protein interactions imex curation Z proteins of New World arenaviruses bind RIG-I and interfere with type I interferon induction. Z proteins of New World arenaviruses bind RIG-I and interfere with type I interferon induction. J. Virol. (0022-538X) 2010 imex curation Fan L., Briese T., Lipkin WI. wil2001@columbia.edu 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. imaging technique imaging technique microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Fan L., Briese T., Lipkin WI. wil2001@columbia.edu Accepted 2011-MAR-02 by ORCHARD 06-April-2011: Contacted by JYOTI. J. Virol. (0022-538X) 2010 orchard Only protein-protein interactions imex curation Z proteins of New World arenaviruses bind RIG-I and interfere with type I interferon induction. Z proteins of New World arenaviruses bind RIG-I and interfere with type I interferon induction. J. Virol. (0022-538X) 2010 imex curation Fan L., Briese T., Lipkin WI. wil2001@columbia.edu 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Fan L., Briese T., Lipkin WI. wil2001@columbia.edu Accepted 2011-MAR-02 by ORCHARD 06-April-2011: Contacted by JYOTI. J. Virol. (0022-538X) 2010 orchard Only protein-protein interactions imex curation ddx58_human Antiviral innate immune response receptor RIG-I DEAD box protein 58 Retinoic acid-inducible gene 1 protein DDX58 Probable ATP-dependent RNA helicase DDX58 Retinoic acid-inducible gene I protein RIG-I-like receptor 1 protein protein human Homo sapiens Human MTTEQRRSLQAFQDYIRKTLDPTYILSYMAPWFREEEVQYIQAEKNNKGPMEAATLFLKFLLELQEEGWFRGFLDALDHAGYSGLYEAIESWDFKKIEKLEEYRLLLKRLQPEFKTRIIPTDIISDLSECLINQECEEILQICSTKGMMAGAEKLVECLLRSDKENWPKTLKLALEKERNKFSELWIVEKGIKDVETEDLEDKMETSDIQIFYQEDPECQNLSENSCPPSEVSDTNLYSPFKPRNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKKFPQGQKGKVVFFANQIPVYEQQKSVFSKYFERHGYRVTGISGATAENVPVEQIVENNDIIILTPQILVNNLKKGTIPSLSIFTLMIFDECHNTSKQHPYNMIMFNYLDQKLGGSSGPLPQVIGLTASVGVGDAKNTDEALDYICKLCASLDASVIATVKHNLEELEQVVYKPQKFFRKVESRISDKFKYIIAQLMRDTESLAKRICKDLENLSQIQNREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFLYTSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRFEEKLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETITILFVKTRALVDALKNWIEGNPKLSFLKPGILTGRGKTNQNTGMTLPAQKCILDAFKASGDHNILIATSVADEGIDIAQCNLVILYEYVGNVIKMIQTRGRGRARGSKCFLLTSNAGVIEKEQINMYKEKMMNDSILRLQTWDEAVFREKILHIQTHEKFIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKDFHFEKIPFDPAEMSK BF0D501C395BAE25 z_gtovv RING finger protein Z Z Zinc-binding protein protein protein gtovv guanarito virus (iso MGNSKSKSNPSSSSESQKGAPTVTEFRRTAIHSLYGRYNCKCCWFADKNLIKCSDHYLCLRCLNVMLKNSDLCNICWEQLPTCITVPEEPSAPPE 191BB9A8F0929570 mavs_human Mitochondrial antiviral-signaling protein Interferon beta promoter stimulator protein 1 Virus-induced-signaling adapter CARD adapter inducing interferon beta Putative NF-kappa-B-activating protein 031N MAVS IPS1 KIAA1271 VISA protein protein human Homo sapiens Human MPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQRRPGWVEYFIAALRGCELVDLADEVASVYQSYQPRTSDRPPDPLEPPSLPAERPGPPTPAAAHSIPYNSCREKEPSYPMPVQETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGHQEQDTELGSTHTAGATSSLTPSRGPVSPSVSFQPLARSTPRASRLPGPTGSVVSTGTSFSSSSPGLASAGAAEGKQGAESDQAEPIICSSGAEAPANSLPSKVPTTLMPVNTVALKVPANPASVSTVPSKLPTSSKPPGAVPSNALTNPAPSKLPINSTRAGMVPSKVPTSMVLTKVSASTVPTDGSSRNEETPAAPTPAGATGGSSAWLDSSSENRGLGSELSKPGVLASQVDSPFSGCFEDLAISASTSLGMGPCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQVAVTGVLVVTLLVVLYRRRLH 0E23E3E115941EE8 z_junin RING finger protein Z Z Zinc-binding protein protein protein juninm Junin mammarenavirus MGNCNGASKSNQPDSSRVTQPAAEFRRVAHSSLYGRYNCKCCWFADTNLITCNDHYLCLRCHQVMLRNSDLCNICWKPLPTTITVPVEPTAPPP 855AA6B39CC46B3B ddx28_human Probable ATP-dependent RNA helicase DDX28 DDX28 MDDX28 Mitochondrial DEAD box protein 28 protein protein human Homo sapiens Human MALTRPVRLFSLVTRLLLAPRRGLTVRSPDEPLPVVRIPVALQRQLEQRQSRRRNLPRPVLVRPGPLLVSARRPELNQPARLTLGRWERAPLASQGWKSRRARRDHFSIERAQQEAPAVRKLSSKGSFADLGLEPRVLHALQEAAPEVVQPTTVQSSTIPSLLRGRHVVCAAETGSGKTLSYLLPLLQRLLGQPSLDSLPIPAPRGLVLVPSRELAQQVRAVAQPLGRSLGLLVRDLEGGHGMRRIRLQLSRQPSADVLVATPGALWKALKSRLISLEQLSFLVLDEADTLLDESFLELVDYILEKSHIAEGPADLEDPFNPKAQLVLVGATFPEGVGQLLNKVASPDAVTTITSSKLHCIMPHVKQTFLRLKGADKVAELVHILKHRDRAERTGPSGTVLVFCNSSSTVNWLGYILDDHKIQHLRLQGQMPALMRVGIFQSFQKSSRDILLCTDIASRGLDSTGVELVVNYDFPPTLQDYIHRAGRVGRVGSEVPGTVISFVTHPWDVSLVQKIELAARRRRSLPGLASSVKEPLPQAT 1FAA4477853893B5 z_machu RING finger protein Z Z Zinc-binding protein protein protein machu machupo virus MACV MGNCNKPPKRPPNTQTSAAQPSAEFRRTALPSLYGRYNCKCCWFADTNLITCNDHYLCLRCHQTMLRNSELCHICWKPLPTSITVPVEPSAPPP 25D09892D9CD1768 z_sabvb RING finger protein Z Z Zinc-binding protein protein protein sabvbm Sabia mammarenavirus (isolate Human/Brasil/SPH114202/1990) MGNSKSKSKLSANQYEQQTVNSTKQVAILKRQAEPSLYGRHNCRCCWFANTNLIKCSDHYICLKCLNIMLGKSSFCDICGEELPTSIVVPIEPSAPPPED 544CCC8FDDD891AD ddx58-z-jun-1 2 8 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait n-terminal region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 2A ddx58-z-jun-2 2 8 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait c-terminal region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 2A ddx58-z-gtov-1 2 5 unspecified role unspecified role bait bait n-terminal region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role prey prey physical association physical association fig. 2a ddx58-z-gtov-2 2 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait c-terminal region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 2A ddx58-z-macv-1 2 5 unspecified role unspecified role bait bait n-terminal region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role prey prey physical association physical association Fig. 2A ddx58-z-macv-2 2 10 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait c-terminal region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 2A ddx58-z-sabv-1 2 11 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait n-terminal region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 2A ddx58-z-sabv-2 2 5 unspecified role unspecified role unspecified role unspecified role c-terminal region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 11 unspecified role unspecified role unspecified role unspecified role physical association physical association Fig. 2A ddx28-z-1 3 8 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Fig. 3B mavs-ddx58-2 4 7 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 4 z-gtov-ddx58 1 6 unspecified role unspecified role bait bait n-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction Fig. 3A z-junv-ddx58 1 8 unspecified role unspecified role bait bait n-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction Fig. 3A z-ddx58 1 5 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role bait bait n-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction Fig. 3A