UniProt UniProt http://www.uniprot.org Human proline-rich nuclear receptor coregulatory protein 2 mediates an interaction between mRNA surveillance machinery and decapping complex. Human proline-rich nuclear receptor coregulatory protein 2 mediates an interaction between mRNA surveillance machinery and decapping complex. Mol. Cell (1097-2765) 2009 mimix curation Cho H., Kim KM., Kim YK. yk-kim@korea.ac.kr 26-Sep-2011: Contacted by JYOTI. human thymus cDNA library mgt yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Cho H., Kim KM., Kim YK. yk-kim@korea.ac.kr Accepted 2011-JUL-12 by MGT 26-Sep-2011: Contacted by JYOTI. human thymus cDNA library Mol. Cell (1097-2765) 2009 mgt mimix curation Human proline-rich nuclear receptor coregulatory protein 2 mediates an interaction between mRNA surveillance machinery and decapping complex. Human proline-rich nuclear receptor coregulatory protein 2 mediates an interaction between mRNA surveillance machinery and decapping complex. Mol. Cell (1097-2765) 2009 mimix curation Cho H., Kim KM., Kim YK. yk-kim@korea.ac.kr 26-Sep-2011: Contacted by JYOTI. human thymus cDNA library mgt chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Cho H., Kim KM., Kim YK. yk-kim@korea.ac.kr Accepted 2011-JUL-12 by MGT 26-Sep-2011: Contacted by JYOTI. human thymus cDNA library Mol. Cell (1097-2765) 2009 mgt mimix curation Human proline-rich nuclear receptor coregulatory protein 2 mediates an interaction between mRNA surveillance machinery and decapping complex. Human proline-rich nuclear receptor coregulatory protein 2 mediates an interaction between mRNA surveillance machinery and decapping complex. Mol. Cell (1097-2765) 2009 mimix curation Cho H., Kim KM., Kim YK. yk-kim@korea.ac.kr 26-Sep-2011: Contacted by JYOTI. human thymus cDNA library mgt human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Cho H., Kim KM., Kim YK. (Fig S5) Transfected myc-tagged PNRC2 was detected by using an anti-myc antibody and endogenous DCP1A was detected using an anti-DCP1A antibody. yk-kim@korea.ac.kr Accepted 2011-JUL-12 by MGT 26-Sep-2011: Contacted by JYOTI. human thymus cDNA library Mol. Cell (1097-2765) 2009 mgt mimix curation Human proline-rich nuclear receptor coregulatory protein 2 mediates an interaction between mRNA surveillance machinery and decapping complex. Human proline-rich nuclear receptor coregulatory protein 2 mediates an interaction between mRNA surveillance machinery and decapping complex. Mol. Cell (1097-2765) 2009 mimix curation Cho H., Kim KM., Kim YK. yk-kim@korea.ac.kr 26-Sep-2011: Contacted by JYOTI. human thymus cDNA library mgt yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Cho H., Kim KM., Kim YK. yk-kim@korea.ac.kr Accepted 2011-JUL-12 by MGT 26-Sep-2011: Contacted by JYOTI. human thymus cDNA library Mol. Cell (1097-2765) 2009 mgt mimix curation Human proline-rich nuclear receptor coregulatory protein 2 mediates an interaction between mRNA surveillance machinery and decapping complex. Human proline-rich nuclear receptor coregulatory protein 2 mediates an interaction between mRNA surveillance machinery and decapping complex. Mol. Cell (1097-2765) 2009 mimix curation Cho H., Kim KM., Kim YK. yk-kim@korea.ac.kr 26-Sep-2011: Contacted by JYOTI. human thymus cDNA library mgt chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Cho H., Kim KM., Kim YK. FLAG-Upf1 is shown to be human in Kim-2005 et al. FLAG-hDcp1a (gift from Lykke-Anderson) has been entered as human with reference to Lykke-Anderson et al, Mol. and Cell Biology 2002. This has not been confrimed by the authors. yk-kim@korea.ac.kr Accepted 2011-JUL-12 by MGT 26-Sep-2011: Contacted by JYOTI. human thymus cDNA library Mol. Cell (1097-2765) 2009 mgt mimix curation Human proline-rich nuclear receptor coregulatory protein 2 mediates an interaction between mRNA surveillance machinery and decapping complex. Human proline-rich nuclear receptor coregulatory protein 2 mediates an interaction between mRNA surveillance machinery and decapping complex. Mol. Cell (1097-2765) 2009 mimix curation Cho H., Kim KM., Kim YK. yk-kim@korea.ac.kr 26-Sep-2011: Contacted by JYOTI. human thymus cDNA library mgt human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Cho H., Kim KM., Kim YK. yk-kim@korea.ac.kr Accepted 2011-JUL-12 by MGT 26-Sep-2011: Contacted by JYOTI. human thymus cDNA library Mol. Cell (1097-2765) 2009 mgt mimix curation Human proline-rich nuclear receptor coregulatory protein 2 mediates an interaction between mRNA surveillance machinery and decapping complex. Human proline-rich nuclear receptor coregulatory protein 2 mediates an interaction between mRNA surveillance machinery and decapping complex. Mol. Cell (1097-2765) 2009 mimix curation Cho H., Kim KM., Kim YK. yk-kim@korea.ac.kr 26-Sep-2011: Contacted by JYOTI. human thymus cDNA library mgt in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Cho H., Kim KM., Kim YK. yk-kim@korea.ac.kr Accepted 2011-JUL-12 by MGT 26-Sep-2011: Contacted by JYOTI. human thymus cDNA library Mol. Cell (1097-2765) 2009 mgt mimix curation Human proline-rich nuclear receptor coregulatory protein 2 mediates an interaction between mRNA surveillance machinery and decapping complex. Human proline-rich nuclear receptor coregulatory protein 2 mediates an interaction between mRNA surveillance machinery and decapping complex. Mol. Cell (1097-2765) 2009 mimix curation Cho H., Kim KM., Kim YK. yk-kim@korea.ac.kr 26-Sep-2011: Contacted by JYOTI. human thymus cDNA library mgt in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Cho H., Kim KM., Kim YK. yk-kim@korea.ac.kr Accepted 2011-JUL-12 by MGT 26-Sep-2011: Contacted by JYOTI. human thymus cDNA library Mol. Cell (1097-2765) 2009 mgt mimix curation Human proline-rich nuclear receptor coregulatory protein 2 mediates an interaction between mRNA surveillance machinery and decapping complex. Human proline-rich nuclear receptor coregulatory protein 2 mediates an interaction between mRNA surveillance machinery and decapping complex. Mol. Cell (1097-2765) 2009 mimix curation Cho H., Kim KM., Kim YK. yk-kim@korea.ac.kr 26-Sep-2011: Contacted by JYOTI. human thymus cDNA library mgt human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Cho H., Kim KM., Kim YK. yk-kim@korea.ac.kr Accepted 2011-JUL-12 by MGT 26-Sep-2011: Contacted by JYOTI. human thymus cDNA library Mol. Cell (1097-2765) 2009 mgt mimix curation pnrc2_human Proline-rich nuclear receptor coactivator 2 PNRC2 HSPC208 protein protein human Homo sapiens Human MGGGERYNIPAPQSRNVSKNQQQLNRQKTKEQNSQMKIVHKKKERGHGYNSSAAAWQAMQNGGKNKNFPNNQSWNSSLSGPRLLFKSQANQNYAGAKFSEPPSPSVLPKPPSHWVPVSFNPSDKEIMTFQLKTLLKVQV 072039CB52551F90 pnrc1_human Proline-rich nuclear receptor coactivator 1 PROL2 Proline-rich protein 2 Protein B4-2 PNRC1 protein protein human Homo sapiens Human MTVVSVPQREPLVLGGRLAPLGFSSRGYFGALPMVTTAPPPLPRIPDPRALPPTLFLPHFLGGDGPCLTPQPRAPAALPNRSLAVAGGTPRAAPKKRRKKKVRASPAGQLPSRFHQYQQHRPSLEGGRSPATGPSGAQEVPGPAAALAPSPAAAAGTEGASPDLAPLRPAAPGQTPLRKEVLKSKMGKSEKIALPHGQLVHGIHLYEQPKINRQKSKYNLPLTKITSAKRNENNFWQDSVSSDRIQKQEKKPFKNTENIKNSHLKKSAFLTEVSQKENYAGAKFSDPPSPSVLPKPPSHWMGSTVENSNQNRELMAVHLKTLLKVQT 97E0D65C2E690763 ddx6_human Probable ATP-dependent RNA helicase DDX6 DDX6 HLR2 RCK DEAD box protein 6 ATP-dependent RNA helicase p54 Oncogene RCK protein protein human Homo sapiens Human MSTARTENPVIMGLSSQNGQLRGPVKPTGGPGGGGTQTQQQMNQLKNTNTINNGTQQQAQSMTTTIKPGDDWKKTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATFPLSVQKFMNSHLQKPYEINLMEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLYVAEYHSEPVEDEKP DIP protein P26196 original sequence version: 65 DIP protein P26196 original sequence version: 114 DIP protein P26196 original sequence version: 138 F802C642861793FB rent2_human Regulator of nonsense transcripts 2 Nonsense mRNA reducing factor 2 Up-frameshift suppressor 2 homolog UPF2 KIAA1408 RENT2 protein protein human Homo sapiens Human MPAERKKPASMEEKDSLPNNKEKDCSERRTVSSKERPKDDIKLTAKKEVSKAPEDKKKRLEDDKRKKEDKERKKKDEEKVKAEEESKKKEEEEKKKHQEEERKKQEEQAKRQQEEEAAAQMKEKEESIQLHQEAWERHHLRKELRSKNQNAPDSRPEENFFSRLDSSLKKNTAFVKKLKTITEQQRDSLSHDFNGLNLSKYIAEAVASIVEAKLKISDVNCAVHLCSLFHQRYADFAPSLLQVWKKHFEARKEEKTPNITKLRTDLRFIAELTIVGIFTDKEGLSLIYEQLKNIINADRESHTHVSVVISFCRHCGDDIAGLVPRKVKSAAEKFNLSFPPSEIISPEKQQPFQNLLKEYFTSLTKHLKRDHRELQNTERQNRRILHSKGELSEDRHKQYEEFAMSYQKLLANSQSLADLLDENMPDLPQDKPTPEEHGPGIDIFTPGKPGEYDLEGGIWEDEDARNFYENLIDLKAFVPAILFKDNEKSCQNKESNKDDTKEAKESKENKEVSSPDDLELELENLEINDDTLELEGGDEAEDLTKKLLDEQEQEDEEASTGSHLKLIVDAFLQQLPNCVNRDLIDKAAMDFCMNMNTKANRKKLVRALFIVPRQRLDLLPFYARLVATLHPCMSDVAEDLCSMLRGDFRFHVRKKDQINIETKNKTVRFIGELTKFKMFTKNDTLHCLKMLLSDFSHHHIEMACTLLETCGRFLFRSPESHLRTSVLLEQMMRKKQAMHLDARYVTMVENAYYYCNPPPAEKTVKKKRPPLQEYVRKLLYKDLSKVTTEKVLRQMRKLPWQDQEVKDYVICCMINIWNVKYNSIHCVANLLAGLVLYQEDVGIHVVDGVLEDIRLGMEVNQPKFNQRRISSAKFLGELYNYRMVESAVIFRTLYSFTSFGVNPDGSPSSLDPPEHLFRIRLVCTILDTCGQYFDRGSSKRKLDCFLVYFQRYVWWKKSLEVWTKDHPFPIDIDYMISDTLELLRPKIKLCNSLEESIRQVQDLEREFLIKLGLVNDKDSKDSMTEGENLEEDEEEEEGGAETEEQSGNESEVNEPEEEEGSDNDDDEGEEEEEENTDYLTDSNKENETDEENTEVMIKGGGLKHVPCVEDEDFIQALDKMMLENLQQRSGESVKVHQLDVAIPLHLKSQLRKGPPLGGGEGEAESADTMPFVMLTRKGNKQQFKILNVPMSSQLAANHWNQQQAEQEERMRMKKLTLDINERQEQEDYQEMLQSLAQRPAPANTNRERRPRYQHPKGAPNADLIFKTGGRRR DIP protein Q9HAU5 original sequence version: 113 DIP protein Q9HAU5-1 original sequence version: 115 DIP protein Q9HAU5 original sequence version: 81 DIP protein Q9HAU5 original sequence version: 82 DIP protein Q9HAU5-1 original sequence version: 82 DIP protein Q9HAU5 original sequence version: 94 DIP protein Q9HAU5-1 original sequence version: 103 95F3C57D2854BB44 rent1_human Regulator of nonsense transcripts 1 UPF1 RENT1 KIAA0221 ATP-dependent helicase RENT1 Nonsense mRNA reducing factor 1 Up-frameshift suppressor 1 homolog protein protein human Homo sapiens Human MSVEAYGPSSQTLTFLDTEEAELLGADTQGSEFEFTDFTLPSQTQTPPGGPGGPGGGGAGGPGGAGAGAAAGQLDAQVGPEGILQNGAVDDSVAKTSQLLAELNFEEDEEDTYYTKDLPIHACSYCGIHDPACVVYCNTSKKWFCNGRGNTSGSHIVNHLVRAKCKEVTLHKDGPLGETVLECYNCGCRNVFLLGFIPAKADSVVVLLCRQPCASQSSLKDINWDSSQWQPLIQDRCFLSWLVKIPSEQEQLRARQITAQQINKLEELWKENPSATLEDLEKPGVDEEPQHVLLRYEDAYQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFTLPKTDSGNEDLVIIWLRDMRLMQGDEICLRYKGDLAPLWKGIGHVIKVPDNYGDEIAIELRSSVGAPVEVTHNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQGNGPVLVCAPSNIAVDQLTEKIHQTGLKVVRLCAKSREAIDSPVSFLALHNQIRNMDSMPELQKLQQLKDETGELSSADEKRYRALKRTAERELLMNADVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVLGAKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPIRLQVQYRMHPALSAFPSNIFYEGSLQNGVTAADRVKKGFDFQWPQPDKPMFFYVTQGQEEIASSGTSYLNRTEAANVEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLNYYKEQKVLVEGPLNNLRESLMQFSKPRKLVNTINPGARFMTTAMYDAREAIIPGSVYDRSSQGRPSSMYFQTHDQIGMISAGPSHVAAMNIPIPFNLVMPPMPPPGYFGQANGPAAGRGTPKGKTGRGGRQKNRFGLPGPSQTNLPNSQASQDVASQPFSQGALTQGYISMSQPSQMSQPGLSQPELSQDSYLGDEFKSQIDVALSQDSTYQGERAYQHGGVTGLSQY DIP protein Q92900 original sequence version: 137 DIP protein Q92900 original sequence version: 76 DIP protein Q92900 original sequence version: 101 DIP protein Q92900 original sequence version: 102 DIP protein Q92900 original sequence version: 135 DIP protein Q92900-1 original sequence version: 123 DIP protein Q92900 original sequence version: 132 6CCA6FE42B15BA28 dcp1a_human mRNA-decapping enzyme 1A DCP1A Transcription factor SMIF Smad4-interacting transcriptional co-activator SMIF protein protein human Homo sapiens Human MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIVNRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDKQSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQPEITTPVLITPASITQSNEKHAPTYTIPLSPVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPRQRSPLLNQPVPELSHASLIANQSPFRAPLNVTNTAGTSLPSVDLLQKLRLTPQHDQIQTQPLGKGAMVASFSPAAGQLATPESFIEPPSKTAAARVAASASLSNMVLAPLQSMQQNQDPEVFVQPKVLSSAIPVAGAPLVTATTTAVSSVLLAPSVFQQTVTRSSDLERKASSPSPLTIGTPESQRKPSIILSKSQLQDTLIHLIKNDSSFLSTLHEVYLQVLTKNKDNHNL DIP protein Q9NPI6 original sequence version: 76 DIP protein Q9NPI6 original sequence version: 96 DIP protein Q9NPI6 original sequence version: 120 26480D0B10CE7C72 upf1-pnrc2 1 14 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association upf1-pnrc1 1 11 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association upf1-upf2-1 1 14 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association upf1-pnrc2-1 2 14 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 1c pnrc2-dcp1a 2 15 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey association association 1d upf1-pnrc2-2 7 14 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 1e not mentioned that purified proteins have been used upf1-pnrc2-3 9 14 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 2a dcp1a-pnrc2 2 14 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey association association 2b pnrc2-upf1 8 10 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association 2c dcp1a-pnrc2-1 6 15 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component colocalization colocalization 3f ddx6-pnrc2 6 10 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component colocalization colocalization 3g dcp1a-upf1-2 3 15 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association 6e upf1-dcp1a-6 3 15 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait association association S5 dcp1a-upf1-1 6 14 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component colocalization colocalization 5C/D, 6C/D, S6D A mutant form of RENT1/Upf1 representing a hyperphosphorylated form has been used. In contrast, unmodified RENT1/UPF1 is evenly distributed in the cytoplasm. upf1-upf2-2 4 14 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association 1a upf1-pnrc2-5 4 10 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association 1a upf1-pnrc1-1 4 11 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association 1a upf1-dcp1a-7 2 15 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait association association 5a ddx6-upf1 6 12 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component colocalization colocalization S6B A mutant form of RENT1/Upf1 representing a hyperphosphorylated form has been used. In contrast, unmodified RENT1/UPF1 is evenly distributed in the cytoplasm. upf1-dcp1a-9 5 10 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait association association 5a