UniProt UniProt http://www.uniprot.org Structure and mechanism of spermidine synthases. Structure and mechanism of spermidine synthases. Biochemistry (0006-2960) 2007 imex curation Wu H., Min J., Ikeguchi Y., Zeng H., Dong A., Loppnau P., Pegg A.E., Plotnikov A.N. alexander.plotnikov@utoronto.ca 26-Sep-2011: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wu H., Min J., Ikeguchi Y., Zeng H., Dong A., Loppnau P., Pegg A.E., Plotnikov A.N. alexander.plotnikov@utoronto.ca Accepted 2011-JUL-04 by ORCHARD 26-Sep-2011: Contacted by JYOTI. Biochemistry (0006-2960) 2007 orchard Only protein-protein interactions imex curation spee_human Spermidine synthase SRM SPS1 SRML1 Putrescine aminopropyltransferase protein protein human Homo sapiens Human MEPGPDGPAASGPAAIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEFARKALNDVS 3EF454D886F6425D spee-1 1 2 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction R-value 0.179 R free 0.228 1.89 A group deposited 4 structures for this protein, (2O05, 2O06, 2O07, 2O0L), showed R-factors and resolution for the one with the highest resolution =2O07