UniProt UniProt http://www.uniprot.org C1D and hMtr4p associate with the human exosome subunit PM/Scl-100 and are involved in pre-rRNA processing. C1D and hMtr4p associate with the human exosome subunit PM/Scl-100 and are involved in pre-rRNA processing. Nucleic Acids Res. (0305-1048) 2007 mimix curation Schilders G., van Dijk E., Pruijn GJ. Apoptosis - Interactions involving proteins with a function related to apoptosis G.Pruijn@ncmls.ru.nl orchard human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Schilders G., van Dijk E., Pruijn GJ. Apoptosis - Interactions involving proteins with a function related to apoptosis G.Pruijn@ncmls.ru.nl Accepted 2011-APR-06 by ORCHARD Nucleic Acids Res. (0305-1048) 2007 orchard mimix curation C1D and hMtr4p associate with the human exosome subunit PM/Scl-100 and are involved in pre-rRNA processing. C1D and hMtr4p associate with the human exosome subunit PM/Scl-100 and are involved in pre-rRNA processing. Nucleic Acids Res. (0305-1048) 2007 mimix curation Schilders G., van Dijk E., Pruijn GJ. Apoptosis - Interactions involving proteins with a function related to apoptosis G.Pruijn@ncmls.ru.nl orchard human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Schilders G., van Dijk E., Pruijn GJ. Apoptosis - Interactions involving proteins with a function related to apoptosis G.Pruijn@ncmls.ru.nl Accepted 2011-APR-06 by ORCHARD Nucleic Acids Res. (0305-1048) 2007 orchard mimix curation C1D and hMtr4p associate with the human exosome subunit PM/Scl-100 and are involved in pre-rRNA processing. C1D and hMtr4p associate with the human exosome subunit PM/Scl-100 and are involved in pre-rRNA processing. Nucleic Acids Res. (0305-1048) 2007 mimix curation Schilders G., van Dijk E., Pruijn GJ. Apoptosis - Interactions involving proteins with a function related to apoptosis G.Pruijn@ncmls.ru.nl orchard in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Schilders G., van Dijk E., Pruijn GJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Source of MPP6 taken from previous work of the author (PMID: 16396833) G.Pruijn@ncmls.ru.nl Accepted 2011-APR-06 by ORCHARD Nucleic Acids Res. (0305-1048) 2007 orchard mimix curation C1D and hMtr4p associate with the human exosome subunit PM/Scl-100 and are involved in pre-rRNA processing. C1D and hMtr4p associate with the human exosome subunit PM/Scl-100 and are involved in pre-rRNA processing. Nucleic Acids Res. (0305-1048) 2007 mimix curation Schilders G., van Dijk E., Pruijn GJ. Apoptosis - Interactions involving proteins with a function related to apoptosis G.Pruijn@ncmls.ru.nl orchard in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Schilders G., van Dijk E., Pruijn GJ. Apoptosis - Interactions involving proteins with a function related to apoptosis G.Pruijn@ncmls.ru.nl Accepted 2011-APR-06 by ORCHARD Nucleic Acids Res. (0305-1048) 2007 orchard mimix curation exos2_human Exosome complex component RRP4 EXOSC2 RRP4 Ribosomal RNA-processing protein 4 Exosome component 2 protein protein human Homo sapiens Human MAMEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEIVMETRQRLLEQEG DIP protein Q13868 original sequence version: 143 882033F50791643F mph6_human M-phase phosphoprotein 6 MPHOSPH6 MPP6 protein protein human Homo sapiens Human MAAERKTRLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKEKESFIIEEQSFLLCEDLLYGRMSFRGFNPEVEKLMLQMNAKHKAEEVEDETVELDVSDEEMARRYETLVGTIGKKFARKRDHANYEEDENGDITPIKAKKMFLKPQD DIP protein Q99547 original sequence version: 125 506D5274C839BD7E exos9_human Exosome complex component RRP45 EXOSC9 PMSCL1 Exosome component 9 Polymyositis/scleroderma autoantigen 1 Autoantigen PM/Scl 1 Polymyositis/scleroderma autoantigen 75 kDa P75 polymyositis-scleroderma overlap syndrome-associated autoantigen protein protein human Homo sapiens Human MKETPLSNCERRFLLRAIEEKKRLDGRQTYDYRNIRISFGTDYGCCIVELGKTRVLGQVSCELVSPKLNRATEGILFFNLELSQMAAPAFEPGRQSDLLVKLNRLMERCLRNSKCIDTESLCVVAGEKVWQIRVDLHLLNHDGNIIDAASIAAIVALCHFRRPDVSVQGDEVTLYTPEERDPVPLSIHHMPICVSFAFFQQGTYLLVDPNEREERVMDGLLVIAMNKHREICTIQSSGGIMLLKDQVLRCSKIAGVKVAEITELILKALENDQKVRKEGGKFGFAESIANQRITAFKMEKAPIDTSDVEEKAEEIIAEAEPPSEVVSTPVLWTPGTAQIGEGVENSWGDLEDSEKEDDEGGGDQAIILDGIKMDTGVEVSDIGSQDAPIILSDSEEEEMIILEPDKNPKKIRTQTTSAKQEKAPSKKPVKRRKKKRAAN DIP protein Q06265 original sequence version: 138 7E27322F094ED3F3 c1d_human Nuclear nucleic acid-binding protein C1D C1D protein protein human Homo sapiens Human MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS mtrex_human Exosome RNA helicase MTR4 MTREX DOB1 KIAA0052 MTR4 SKIV2L2 Superkiller viralicidic activity 2-like 2 TRAMP-like complex helicase ATP-dependent RNA helicase DOB1 ATP-dependent RNA helicase SKIV2L2 protein protein human Homo sapiens Human MADAFGDELFSVFEGDSTTAAGTKKDKEKDKGKWKGPPGSADKAGKRFDGKLQSESTNNGKNKRDVDFEGTDEPIFGKKPRIEESITEDLSLADLMPRVKVQSVETVEGCTHEVALPAEEDYLPLKPRVGKAAKEYPFILDAFQREAIQCVDNNQSVLVSAHTSAGKTVCAEYAIALALREKQRVIFTSPIKALSNQKYREMYEEFQDVGLMTGDVTINPTASCLVMTTEILRSMLYRGSEVMREVAWVIFDEIHYMRDSERGVVWEETIILLPDNVHYVFLSATIPNARQFAEWICHLHKQPCHVIYTDYRPTPLQHYIFPAGGDGLHLVVDENGDFREDNFNTAMQVLRDAGDLAKGDQKGRKGGTKGPSNVFKIVKMIMERNFQPVIIFSFSKKDCEAYALQMTKLDFNTDEEKKMVEEVFSNAIDCLSDEDKKLPQVEHVLPLLKRGIGIHHGGLLPILKETIEILFSEGLIKALFATETFAMGINMPARTVLFTNARKFDGKDFRWISSGEYIQMSGRAGRRGMDDRGIVILMVDEKMSPTIGKQLLKGSADPLNSAFHLTYNMVLNLLRVEEINPEYMLEKSFYQFQHYRAIPGVVEKVKNSEEQYNKIVIPNEESVVIYYKIRQQLAKLGKEIEEYIHKPKYCLPFLQPGRLVKVKNEGDDFGWGVVVNFSKKSNVKPNSGELDPLYVVEVLLRCSKESLKNSATEAAKPAKPDEKGEMQVVPVLVHLLSAISSVRLYIPKDLRPVDNRQSVLKSIQEVQKRFPDGIPLLDPIDDMGIQDQGLKKVIQKVEAFEHRMYSHPLHNDPNLETVYTLCEKKAQIAIDIKSAKRELKKARTVLQMDELKCRKRVLRRLGFATSSDVIEMKGRVACEISSADELLLTEMMFNGLFNDLSAEQATALLSCFVFQENSSEMPKLTEQLAGPLRQMQECAKRIAKVSAEAKLEIDEETYLSSFKPHLMDVVYTWATGATFAHICKMTDVFEGSIIRCMRRLEELLRQMCQAAKAIGNTELENKFAEGITKIKRDIVFAASLYL 49F47BEC753FBEE7 exosx_human Exosome component 10 PMSCL2 EXOSC10 PMSCL Polymyositis/scleroderma autoantigen 2 Autoantigen PM/Scl 2 Polymyositis/scleroderma autoantigen 100 kDa P100 polymyositis-scleroderma overlap syndrome-associated autoantigen RRP6 protein protein human Homo sapiens Human MAPPSTREPRVLSATSATKSDGEMVLPGFPDADSFVKFALGSVVAVTKASGGLPQFGDEYDFYRSFPGFQAFCETQGDRLLQCMSRVMQYHGCRSNIKDRSKVTELEDKFDLLVDANDVILERVGILLDEASGVNKNQQPVLPAGLQVPKTVVSSWNRKAAEYGKKAKSETFRLLHAKNIIRPQLKFREKIDNSNTPFLPKIFIKPNAQKPLPQALSKERRERPQDRPEDLDVPPALADFIHQQRTQQVEQDMFAHPYQYELNHFTPADAVLQKPQPQLYRPIEETPCHFISSLDELVELNEKLLNCQEFAVDLEHHSYRSFLGLTCLMQISTRTEDFIIDTLELRSDMYILNESLTDPAIVKVFHGADSDIEWLQKDFGLYVVNMFDTHQAARLLNLGRHSLDHLLKLYCNVDSNKQYQLADWRIRPLPEEMLSYARDDTHYLLYIYDKMRLEMWERGNGQPVQLQVVWQRSRDICLKKFIKPIFTDESYLELYRKQKKHLNTQQLTAFQLLFAWRDKTARREDESYGYVLPNHMMLKIAEELPKEPQGIIACCNPVPPLVRQQINEMHLLIQQAREMPLLKSEVAAGVKKSGPLPSAERLENVLFGPHDCSHAPPDGYPIIPTSGSVPVQKQASLFPDEKEDNLLGTTCLIATAVITLFNEPSAEDSKKGPLTVAQKKAQNIMESFENPFRMFLPSLGHRAPVSQAAKFDPSTKIYEISNRWKLAQVQVQKDSKEAVKKKAAEQTAAREQAKEACKAAAEQAISVRQQVVLENAAKKRERATSDPRTTEQKQEKKRLKISKKPKDPEPPEKEFTPYDYSQSDFKAFAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRGFRYNWPQR DIP protein Q01780 original sequence version: 154 A37BDC8F49BF2E57 c1d-exosc10 1 8 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component colocalization colocalization 1b exosc10-skiv2l2 1 10 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component colocalization colocalization 1B exosc9-exosc10-1 2 5 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait association association 2A c1d-exosc10-5 2 8 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey association association 2A exosc10-c1d 4 8 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait direct interaction direct interaction 2B exosc10-mphosph6-1 4 10 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey direct interaction direct interaction 2B c1d-exosc10-3 3 8 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey direct interaction direct interaction 2C mphosph6-exosc10 3 10 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait direct interaction direct interaction 2C mphosph6-skiv2l2 3 6 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey direct interaction direct interaction 2D c1d-exosc10-4 3 8 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey physical association physical association 3