IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The Apollo 5' exonuclease functions together with TRF2 to protect telomeres from DNA repair. The Apollo 5' exonuclease functions together with TRF2 to protect telomeres from DNA repair. Curr. Biol. (0960-9822) 2006 imex curation Lenain C., Bauwens S., Amiard S., Brunori M., Giraud-Panis MJ., Gilson E. eric.gilson@ens-lyon.fr orchard Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Lenain C., Bauwens S., Amiard S., Brunori M., Giraud-Panis MJ., Gilson E. eric.gilson@ens-lyon.fr Accepted 2011-MAR-01 by ORCHARD Curr. Biol. (0960-9822) 2006 orchard Only protein-protein interactions imex curation The Apollo 5' exonuclease functions together with TRF2 to protect telomeres from DNA repair. The Apollo 5' exonuclease functions together with TRF2 to protect telomeres from DNA repair. Curr. Biol. (0960-9822) 2006 imex curation Lenain C., Bauwens S., Amiard S., Brunori M., Giraud-Panis MJ., Gilson E. eric.gilson@ens-lyon.fr orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lenain C., Bauwens S., Amiard S., Brunori M., Giraud-Panis MJ., Gilson E. eric.gilson@ens-lyon.fr Accepted 2011-MAR-01 by ORCHARD Curr. Biol. (0960-9822) 2006 orchard Only protein-protein interactions imex curation The Apollo 5' exonuclease functions together with TRF2 to protect telomeres from DNA repair. The Apollo 5' exonuclease functions together with TRF2 to protect telomeres from DNA repair. Curr. Biol. (0960-9822) 2006 imex curation Lenain C., Bauwens S., Amiard S., Brunori M., Giraud-Panis MJ., Gilson E. eric.gilson@ens-lyon.fr orchard Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 pull down pull down anti tag western anti tag western blot anti tag western Lenain C., Bauwens S., Amiard S., Brunori M., Giraud-Panis MJ., Gilson E. eric.gilson@ens-lyon.fr Accepted 2011-MAR-01 by ORCHARD Curr. Biol. (0960-9822) 2006 orchard Only protein-protein interactions imex curation The Apollo 5' exonuclease functions together with TRF2 to protect telomeres from DNA repair. The Apollo 5' exonuclease functions together with TRF2 to protect telomeres from DNA repair. Curr. Biol. (0960-9822) 2006 imex curation Lenain C., Bauwens S., Amiard S., Brunori M., Giraud-Panis MJ., Gilson E. eric.gilson@ens-lyon.fr orchard Only protein-protein interactions human-fibroblast Homo sapiens normal diploid fibroblasts (HDF0 fibroblast Fibroblast fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Lenain C., Bauwens S., Amiard S., Brunori M., Giraud-Panis MJ., Gilson E. eric.gilson@ens-lyon.fr Accepted 2011-MAR-01 by ORCHARD Curr. Biol. (0960-9822) 2006 orchard Only protein-protein interactions imex curation The Apollo 5' exonuclease functions together with TRF2 to protect telomeres from DNA repair. The Apollo 5' exonuclease functions together with TRF2 to protect telomeres from DNA repair. Curr. Biol. (0960-9822) 2006 imex curation Lenain C., Bauwens S., Amiard S., Brunori M., Giraud-Panis MJ., Gilson E. eric.gilson@ens-lyon.fr orchard Only protein-protein interactions human-bj Homo sapiens BJ normal foreskin fibroblasts bj Human normal foreskin fibroblasts The ATCC rference number is CRL-2522. The ATCC reference number is CRL-2522. fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Lenain C., Bauwens S., Amiard S., Brunori M., Giraud-Panis MJ., Gilson E. eric.gilson@ens-lyon.fr Accepted 2011-MAR-01 by ORCHARD Curr. Biol. (0960-9822) 2006 orchard Only protein-protein interactions imex curation dcr1b_human 5' exonuclease Apollo DCLRE1B SNM1B DNA cross-link repair 1B protein SNM1 homolog B Beta-lactamase DCLRE1B protein protein human Homo sapiens Human MNGVLIPHTPIAVDFWSLRRAGTARLFFLSHMHSDHTVGLSSTWARPLYCSPITAHLLHRHLQVSKQWIQALEVGESHVLPLDEIGQETMTVTLLDANHCPGSVMFLFEGYFGTILYTGDFRYTPSMLKEPALTLGKQIHTLYLDNTNCNPALVLPSRQEAAHQIVQLIRKHPQHNIKIGLYSLGKESLLEQLALEFQTWVVLSPRRLELVQLLGLADVFTVEEKAGRIHAVDHMEICHSNMLRWNQTHPTIAILPTSRKIHSSHPDIHVIPYSDHSSYSELRAFVAALKPCQVVPIVSRRPCGGFQDSLSPRISVPLIPDSVQQYMSSSSRKPSLLWLLERRLKRPRTQGVVFESPEESADQSQADRDSKKAKKEKLSPWPADLEKQPSHHPLRIKKQLFPDLYSKEWNKAVPFCESQKRVTMLTAPLGFSVHLRSTDEEFISQKTREEIGLGSPLVPMGDDDGGPEATGNQSAWMGHGSPLSHSSKGTPLLATEFRGLALKYLLTPVNFFQAGYSSRRFDQQVEKYHKPC DIP protein Q9H816 original sequence version: 82 DIP protein Q9H816 original sequence version: 79 601A800CCD43CFDA terf1_human Telomeric repeat-binding factor 1 TTAGGG repeat-binding factor 1 NIMA-interacting protein 2 Telomeric protein Pin2/TRF1 TERF1 PIN2 TRF TRF1 TRBF1 protein protein human Homo sapiens Human MAEDVSSAAPSPRGCADGRDADPTEEQMAETERNDEEQFECQELLECQVQVGAPEEEEEEEEDAGLVAEAEAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRNSAEAIIHGLSSLTACQLRTIYICQFLTRIAAGKTLDAQFENDERITPLESALMIWGSIEKEHDKLHEEIQNLIKIQAIAVCMENGNFKEAEEVFERIFGDPNSHMPFKSKLLMIISQKDTFHSFFQHFSYNHMMEKIKSYVNYVLSEKSSTFLMKAAAKVVESKRTRTITSQDKPSGNDVEMETEANLDTRKSVSDKQSAVTESSEGTVSLLRSHKNLFLSKLQHGTQQQDLNKKERRVGTPQSTKKKKESRRATESRIPVSKSQPVTPEKHRARKRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTMKKLKLISSDSED DIP protein P54274 original sequence version: 121 DIP protein P54274-1 original sequence version: 81 DIP protein P54274 original sequence version: 168 AB548E7D3124A211 terf2_human Telomeric repeat-binding factor 2 TTAGGG repeat-binding factor 2 Telomeric DNA-binding protein TERF2 TRF2 TRBF2 protein protein human Homo sapiens Human MAAGAGTAGPASGPGVVRDPAASQPRKRPGREGGEGARRSDTMAGGGGSSDGSGRAAGRRASRSSGRARRGRHEPGLGGPAERGAGEARLEEAVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQALLVRPLGKEHTVSRLLRVMQCLSRIEEGENLDCSFDMEAELTPLESAINVLEMIKTEFTLTEAVVESSRKLVKEAAVIICIKNKEFEKASKILKKHMSKDPTTQKLRNDLLNIIREKNLAHPVIQNFSYETFQQKMLRFLESHLDDAEPYLLTMAKKALKSESAASSTGKEDKQPAPGPVEKPPREPARQLRNPPTTIGMMTLKAAFKTLSGAQDSEAAFAKLDQKDLVLPTQALPASPALKNKRPRKDENESSAPADGEGGSELQPKNKRMTISRLVLEEDSQSTEPSAGLNSSQEAASAPPSKPTVLNQPLPGEKNPKVPKGKWNSSNGVEEKETWVEEDELFQVQAAPDEDSTTNITKKQKWTVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAVMIKDRWRTMKRLGMN DIP protein Q15554 original sequence version: 107 DIP protein Q15554 original sequence version: 109 DIP protein Q15554 original sequence version: 121 DIP protein Q15554 original sequence version: 157 DIP protein Q15554-3 original sequence version: 115 3A278AC6B594C43A terf2-dcr1b 2 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain [EBI-3510286] The range 43-269 was N-terminal and is not anymore. 13 11 physical association physical association Fig. 1A terf2-dcr1b-1 3 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1D, 1E terf2-dclre1b 3 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figs. 1B, 1F, 1G dclre1b-terf2 1 6 unspecified role unspecified role unspecified role unspecified role region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role unspecified role unspecified role colocalization colocalization dclre1b-terf2-1 4 6 unspecified role unspecified role unspecified role unspecified role region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role unspecified role unspecified role colocalization colocalization dclre1b-terf1 4 7 unspecified role unspecified role unspecified role unspecified role 6 unspecified role unspecified role unspecified role unspecified role region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization dclre1b-terf2-2 5 8 unspecified role unspecified role unspecified role unspecified role 6 unspecified role unspecified role unspecified role unspecified role region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization dclre1b-terf1-1 5 7 unspecified role unspecified role unspecified role unspecified role 6 unspecified role unspecified role unspecified role unspecified role region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization