IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Direct and heterologous approaches to identify the LET-756/FGF interactome. Direct and heterologous approaches to identify the LET-756/FGF interactome. BMC Genomics (null) 2006 imex curation Popovici C., Berda Y., Conchonaud F., Harbis A., Birnbaum D., Roubin R. roubin@marseille.inserm.fr 06-Jun-2011: Contacted by JYOTI. Two cDNA libraries were used, either derived from mixed stages worms, or from a normalized library, containing one representative of each expressed gene of the whole genome (ORFeome). jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Popovici C., Berda Y., Conchonaud F., Harbis A., Birnbaum D., Roubin R. For the sequence name C15C8.3, two UniProt proteins were found ( Q18020 and E0AHB8) . The longer protein has been entered as both proteins have an identical sequence for aas 240 - end. roubin@marseille.inserm.fr Accepted 2011-APR-19 by JYOTI 06-Jun-2011: Contacted by JYOTI. Two cDNA libraries were used, either derived from mixed stages worms, or from a normalized library, containing one representative of each expressed gene of the whole genome (ORFeome). BMC Genomics (null) 2006 jyoti Only protein-protein interactions imex curation Direct and heterologous approaches to identify the LET-756/FGF interactome. Direct and heterologous approaches to identify the LET-756/FGF interactome. BMC Genomics (null) 2006 imex curation Popovici C., Berda Y., Conchonaud F., Harbis A., Birnbaum D., Roubin R. roubin@marseille.inserm.fr 06-Jun-2011: Contacted by JYOTI. Two cDNA libraries were used, either derived from mixed stages worms, or from a normalized library, containing one representative of each expressed gene of the whole genome (ORFeome). jyoti Only protein-protein interactions chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Popovici C., Berda Y., Conchonaud F., Harbis A., Birnbaum D., Roubin R. have not added RCF-2 (F58F6.4) as no mention is made of it in the text, and it is hard to work out from the image if there is any yellow (merge) colour there, or not. (but i cant see any yellow for RPL-6 either, but text says this IS co-localised -so ??) anti-tag immunostaining RCF-2 (F58F6.4) has not been added as in interactor, as no mention is made of it in the text. roubin@marseille.inserm.fr Accepted 2011-APR-19 by JYOTI 06-Jun-2011: Contacted by JYOTI. Two cDNA libraries were used, either derived from mixed stages worms, or from a normalized library, containing one representative of each expressed gene of the whole genome (ORFeome). BMC Genomics (null) 2006 jyoti Only protein-protein interactions imex curation Direct and heterologous approaches to identify the LET-756/FGF interactome. Direct and heterologous approaches to identify the LET-756/FGF interactome. BMC Genomics (null) 2006 imex curation Popovici C., Berda Y., Conchonaud F., Harbis A., Birnbaum D., Roubin R. roubin@marseille.inserm.fr 06-Jun-2011: Contacted by JYOTI. Two cDNA libraries were used, either derived from mixed stages worms, or from a normalized library, containing one representative of each expressed gene of the whole genome (ORFeome). jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Popovici C., Berda Y., Conchonaud F., Harbis A., Birnbaum D., Roubin R. For the sequence name C15C8.3, two UniProt proteins were found ( Q18020 and E0AHB8) . The longer protein has been entered as both proteins have an identical sequence for aas 240 - end. roubin@marseille.inserm.fr Accepted 2011-APR-19 by JYOTI 06-Jun-2011: Contacted by JYOTI. Two cDNA libraries were used, either derived from mixed stages worms, or from a normalized library, containing one representative of each expressed gene of the whole genome (ORFeome). BMC Genomics (null) 2006 jyoti Only protein-protein interactions imex curation Direct and heterologous approaches to identify the LET-756/FGF interactome. Direct and heterologous approaches to identify the LET-756/FGF interactome. BMC Genomics (null) 2006 imex curation Popovici C., Berda Y., Conchonaud F., Harbis A., Birnbaum D., Roubin R. roubin@marseille.inserm.fr 06-Jun-2011: Contacted by JYOTI. Two cDNA libraries were used, either derived from mixed stages worms, or from a normalized library, containing one representative of each expressed gene of the whole genome (ORFeome). jyoti Only protein-protein interactions chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Popovici C., Berda Y., Conchonaud F., Harbis A., Birnbaum D., Roubin R. roubin@marseille.inserm.fr Accepted 2011-APR-19 by JYOTI 06-Jun-2011: Contacted by JYOTI. Two cDNA libraries were used, either derived from mixed stages worms, or from a normalized library, containing one representative of each expressed gene of the whole genome (ORFeome). BMC Genomics (null) 2006 jyoti Only protein-protein interactions imex curation Direct and heterologous approaches to identify the LET-756/FGF interactome. Direct and heterologous approaches to identify the LET-756/FGF interactome. BMC Genomics (null) 2006 imex curation Popovici C., Berda Y., Conchonaud F., Harbis A., Birnbaum D., Roubin R. roubin@marseille.inserm.fr 06-Jun-2011: Contacted by JYOTI. Two cDNA libraries were used, either derived from mixed stages worms, or from a normalized library, containing one representative of each expressed gene of the whole genome (ORFeome). jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Popovici C., Berda Y., Conchonaud F., Harbis A., Birnbaum D., Roubin R. KRAB100 has not been added as an interactor as it cannot be identified. roubin@marseille.inserm.fr Accepted 2011-APR-19 by JYOTI 06-Jun-2011: Contacted by JYOTI. Two cDNA libraries were used, either derived from mixed stages worms, or from a normalized library, containing one representative of each expressed gene of the whole genome (ORFeome). BMC Genomics (null) 2006 jyoti Only protein-protein interactions imex curation gslg1_caeel Golgi apparatus protein 1 homolog F14E5.2 protein protein caeel Caenorhabditis elegans MWRFPLILASVCWLTTAQQQNVANDPDKKLASFDACKADIHKHCSRPDVDLTSDMSILECLQDAGFSETATLSEQCEQLVWDFKVKITQDERFVSAAKQYCEEELKGNAAMNLCTSQTQPGFALSCLMEFTKNVTETGKCHAFLARTERLAFSDFRLVGPFVTKCRAILDKFKCNVLTPDPAHKGVRVAHTQGMALECILDKVVKNAKTQADALQILGDDCKHEVLRLAEMQADDFHLDRPLFFACRLDRERYCKDVPSGEGKVFECLMMNRNDKFMDPECGNLLAERAYLMGRDYRMAHPLTKACQPELTRYKCEPQNQIESAAHFHLAWILLCLENGANQPEHKEVQPSKECAHEMITHRQMMMQHFRMAPELVLNCAQEIDKWCSPRGDIEAEGRTLHCLMEHAESRNETLKLGAQCLQAVQQVVKVADIGRNYKVDKVLYGSCRSLIDGPCAQDAVSETATLTCLMRNVDSPDMVPECEKRLLEVQYFMARDWTMDPQLYEACHQEAVSRCSALDNWHQQHNSDNTVDRGPQVLACLYRSAYDEQNPLSVKCGTQVRQLLHVRAVRVNLIPEIEDSCREALSEFCSHNVKPSEEMMCLQQNFETDNFKRKHPQCFAELTKFTEMEAKDTKLNRALSKACKPVISTHCAQFANEEIDHGDVLECLVNNKDAKEMNNKCRSYVNHFELISLRDYHFSYKFQKACASDIEQSCKGHNNDKGEIIRCLSEVRFEHKVLGSPKDLTDDCKKQLKVAYLQQEQVEFDDKEHMADADPKLSQKCEQEIKMYKCNQADTFEDTIECLRLNFEHLGPECKSMIFYREKIEAVDNSMDDELQKKCRYDIGKFCANSDSENVLECLTNTKIVRLLQRECKAIVKERMQESARDVRLRPQLLTSCRKEAEQYCPEDMKKINMPQYSQTVLDGVVVSCLRDKFRQSISDQNHIDFSPRCSAEVSRAIVEAEFDPQLDPPLYNACKSTINDHCSATIMESGGHFDNVMECLKNDFNKGLIRDKQCSEQVARRLQESLVDIHLDPVLHEACAMDIQRYCRDVPPGHSRIVMCLMDSADKQELSKECSTKLSDRNKLWMKAHSEFQMALPDSWHAFANLVMEHPERNSILGYLAGFIVFILLIGCCCGRVSKKQYIEMKNR FD81BE02572B8F79 q20000_caeel F35A5.4 CELE_F35A5.4 protein protein caeel Caenorhabditis elegans MQYLIAAFAVFQLSLGDEFSTSALTSPYLKMNGSLITRVRSKRQCCAMCPSGNCGCGSCSGFVTCPDRCQPMCTQACVMAKTSVCVDQCMPKCDSACINLVRSGPSCDQQCMPLCLPACINAIQGPTECAPQCMPSCSSNCIQQVFPSCPQQCQPVCTPQCIQSIQVAIQRPTCASSCMPSCSQSCIQKYEITVEQETCVPACMPACSSACVQAVTCSTCTNNCPSICSQANCIPQCMPRCLPTCIQQIQISVPLPPPAPRCDSMCMPSCSPSCVQQYSLCPQQCRPMCTNACVTNLQVSRPVSQCLPACMPSCTSSCVQSMCPQQCYPSCDMNCIQQYAVQMAPTPCAAQCMPLCESSCIARLSCVQTCMPACSPTCVQNYAAGPIQCAPACMPLCQPTCVQQHAEVVVACGVPCQCQPGYVQCSQNLCCLKYKNMAAKFRKLSGSTTNSNNNGNNGHNNGPNNNNDEDDEDNNSAGGSYTEPMRDSPKTSKSNSTSSEEKNSGKTLSAFSDTQMDGDSYAKA 0C6E75FA60DDCB6A umps_caeel Uridine 5'-monophosphate synthase umps-1 rad-6 T07C4.1 protein protein caeel Caenorhabditis elegans MSSLTDKTRNGALKRNLLRQMLKASVFKFGEFQLKSGQISPIYIDLRECFGHPGLLMLISEAISKQVEISEVQYAGVLGIPYAALPYASVAAGNYLKKPLLIVRKEAKSYGTKKLIEGLYQPNDRLILIEDVVTTGGSILDVVKVLHTENLVASDVFCILDREQGGRQKLQDAGVTLHSLLDMQTVLTFLYSTGAIGDEQWHGIVQALNLPYTSPTKLEINSELENLSSLPYVENVRTPLAERESLTESALIKKILGIMRRKKSNLCLAVDYTTVEQCLQMIELAGPFVLAIKLHADAITDFNEEFTRKLTTMANDMDFIIFEDRKFGDTGNTNLLQLTGAQKIANWADVVTVHAVQGSDSIAGVFRKLAKDPTYRLSGVLLIAQLSTKGSLTALEGYTETAVKIANENRDVISGFITQTRVSACSDLLNWTPGVNLDAKSDSAGQQWRGVDEAIEVQQNDIIIVGRGVTSSSEPVQQLKRYRQIAWDALTRSDDSI 789AE78A9DE50233 q21556_caeel M18.1 col-129 CELE_M18.1 protein protein caeel Caenorhabditis elegans MSTARYLVSIAAAASTFAVLASIVSLVYLVNDVNNYYDDVTRNIENFKDDANTVWHQMMTVVPQGGKQRQVYESLFGRTKRQAAQCNCGANSAASNCPAGPPGPPGAPGEDGDHGLVGEDGTPGADGNLGVPLSANGCIVCPAGPPGPPGQPGQNGQRGSDGQPGQDAMGGGQGAPGPQGPAGDNGQPGRPGNDGRPGAPGAPGTRSVGRPGTAGSPGPQGPPGQNGNDGQPGNDGAPGQPGQPGPDGHPGQPGNAGPPGTPGAAGQPGGDAAYCPCPSRSSVVRAQAAVARNRHVAARHRSVSRRKAVAARRSKARRVVAAKHRAVAKRHRAVQKA 638C0ED0B381EA4E le756_caeel Protein let-756 let-756 Lethal protein 756 C05D11.4 protein protein caeel Caenorhabditis elegans MAVPAASSIVSYGGAATSNFLTTPVTPFLAGFYNSNFVTDRINSCAPYRVDRIRKQLQDEEENGYPPADDRRRGALFCRSGTWLEMLPIENPDDGSTRVKVHGTKEESSKFSIVEFVSVAMSLVSIRGVETKNFICMDPSGKLYATPSSNYSTECVFLEEMMENYYNLYASCAYGDRFNPWYIELRRSGKPRRGPNSKKRRKASHFLVVHHDLDRLRSPVPNGNDVTDLVVASLFHQPPSHPLFRQQTVTKPPNPHRISNLRAKVEMTNQAEKQRLLEEKKRRREKKKRRREDRLRKEEQIREARRQELKSLREEELRRRYQQQQQQQASTQTRYNRPQNPANPYPTYRPLPTRSTVQSPRPAYNPYWQSPVTQAPHHNSHHHHHHHPRVSSSSDPQQRHQSQQHYLAQTVSNPNRQNVNYQRYP E04A5A2D94F044D2 csk2a_caeel Casein kinase II subunit alpha B0205.7 kin-3 protein protein caeel Caenorhabditis elegans MPPIPSRARVYAEVNPSRPREYWDYEAHMIEWGQIDDYQLVRKLGRGKYSEVFEGFKMSTDEKVVVKILKPVKKKKIKREIKILENLRGGTNIITLLDVVKDPISRTPALIFEHVNNSDFKQLYQTLSDYDIRYYLYELLKALDFCHSQGIMHRDVKPHNVMIDAEKRELRLIDWGLAEFYHPRQDYNVRVASRYFKGPELLVDYQCYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTDELYEYIARYHIDLDPRFNDILGRHSRKRWERFIHAENQHLVTPEALDFLDKLLRYDHAERLTAQEAMGHEYFRPVVEAHARANGTEQADGQGASNSASSQSSDAKIDGA B98DF039F6B566FA ebp2_caeel Probable rRNA-processing protein EBP2 homolog C18A3.3 protein protein caeel Caenorhabditis elegans MVRKMNKLAKRLASTSKSRQPEPESDSDGSEFDFDNAIEEKPMEAMDIEEVESDGDDDERELQAAFAAGLLKDGLNIQVAKKRPIINKSAEMKEKLAEITKDLPWVETLEVVTPHSEMDKKVENDDFQRELNFYKQAEKAVQIAYPRLLNLGIKVLRPTDYYAEMAKSDTHMQKVRKRLLGIQEMKERQEAFRRIREEKKFAVKVQKEVLAAKNTEKKNLAEAVKKHKKGMKQQLEDMLNNVKRHGLDQDDDAPTGAFGDRLGGRGGAGRGGAGRGGSMRNAGELKRKLKSDKFGYGGKKKGMKRNNKESFNDLFGAPRGGFGGRGRGGGRGGRGGRGRR 13EE225D985A5D55 14332_caeel 14-3-3-like protein 2 ftt-2 F52D10.3 protein protein caeel Caenorhabditis elegans MSDGKEELVNRAKLAEQAERYDDMAASMKKVTELGAELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQQMAKEYREKVEKELRDICQDVLNLLDKFLIPKAGAAESKVFYLKMKGDYYRYLAEVASGDDRNSVVEKSQQSYQEAFDIAKDKMQPTHPIRLGLALNFSVFFYEILNAPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAATDDTDANETEGGN 566D9CF5DB7A4B96 hsp6_caeel Heat shock protein hsp-6 hsp-6 hsp70f C37H5.8 Heat shock 70 kDa protein F, mitochondrial mot-2 protein protein caeel Caenorhabditis elegans MLSARSFLSSARTIARSSLMSARSLSDKPKGHVIGIDLGTTNSCVSIMEGKTPKVIENAEGVRTTPSTVAFTADGERLVGAPAKRQAVTNSANTLFATKRLIGRRYEDPEVQKDLKVVPYKIVKASNGDAWVEAQGKVYSPSQVGAFVLMKMKETAESYLGTTVNNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKDAGDKIIAVYDLGGGTFDVSILEIQKGVFEVKSTNGDTFLGGEDFDHALVHHLVGEFKKEQGVDLTKDPQAMQRLREAAEKAKCELSSTTQTDINLPYITMDQSGPKHLNLKLTRAKFEQIVGDLIKRTIEPCRKALHDAEVKSSQIADVLLVGGMSRMPKVQATVQEIFGKVPSKAVNPDEAVAMGAAIQGAVLAGDVTDVLLLDVTPLSLGIETLGGIMTKLITRNTTIPTKKSQVFSTAADGQTQVQIKVFQGEREMATSNKLLGQFSLVGIPPAPRGVPQVEVTFDIDANGIVNVSARDRGTGKEQQIVIQSSGGLSKDQIENMIKEAEKNAAEDAKRKELVEVINQAEGIIHDTEAKMTEFADQLPKDECEALRTKIADTKKILDNKDNETPEAIKEACNTLQQQSLKLFEAAYKNMAAKNSGGDAQEAKTAEEPKKEQN 637A1636B6ABB836 csk2b_caeel Casein kinase II subunit beta kin-10 kin-5 T01G9.6 protein protein caeel Caenorhabditis elegans MSSSEEVSWITWFCGLRGNEFFCEVDEEYIQDRFNLTGLNEQVPKYRQALDMILDLEPDDIEDNATNTDLVEQAAEMLYGLIHARYILTNRGISQMVEKWRDHDFGVCPRVYCENQPMLPIGLSDVPGEAMVKLYCPRCNDVFVPRSSRHQHTDGSYFGTGFPHMLFFVHPDLRPRRPVTQFVPKLYGFKIHPVAYGGQEGNSGGNTANNVAAAQNNTTPAGQQSGGQFNNYGL 634E76B78761AD74 g5edd8_caeel Skp1-related protein skr-2 CELE_F46A9.4 F46A9.4 protein protein caeel Caenorhabditis elegans MADQKEASEAAKNREIKISSSDDEIFLVPRNVIRLSNTLNTLLVDLGLDDDEGTNAEPIPVQNVTASILKKVINWCTKHQSDPIPTEDSEKKTDGSIQDWDKKFLDIDQGTLFELILAANYLDIKGLLDVACQSVANMIKGKSPDEIRRAFNIKDDFTAEEREQIRKENAWCDD 5BDD662F27E5EDDF rl6_caeel 60S ribosomal protein L6 rpl-6 R151.3 protein protein caeel Caenorhabditis elegans MVGKRNLPVISRNFDLSPGVLRFSASRLRLKKGEKKPKFTKDTSAKLPKLQRNGTKFALGHSKTVTLRKTLTPGTVLIVLAGRHKGKRVVFLKQLPQSGLLLVTGPHKINGFPLRRIGQAFVIATSLKVNVSGVKIPEHINDEYFKRKSTAQKTGKNIFASGKTEYTVSEQRKKDIKTVDAPILAAIKKHPEHKFLFGYLGTRFSLGKNQYPHKMQF 5BA7FE473B1C239B mbd1_human Methyl-CpG-binding domain protein 1 CXXC3 Methyl-CpG-binding protein MBD1 Protein containing methyl-CpG-binding domain 1 CXXC-type zinc finger protein 3 MBD1 PCM1 protein protein human Homo sapiens Human MAEDWLDCPALGPGWKRREVFRKSGATCGRSDTYYQSPTGDRIRSKVELTRYLGPACDLTLFDFKQGILCYPAPKAHPVAVASKKRKKPSRPAKTRKRQVGPQSGEVRKEAPRDETKADTDTAPASFPAPGCCENCGISFSGDGTQRQRLKTLCKDCRAQRIAFNREQRMFKRVGCGECAACQVTEDCGACSTCLLQLPHDVASGLFCKCERRRCLRIVERSRGCGVCRGCQTQEDCGHCPICLRPPRPGLRRQWKCVQRRCLRGKHARRKGGCDSKMAARRRPGAQPLPPPPPSQSPEPTEPHPRALAPSPPAEFIYYCVDEDELQPYTNRRQNRKCGACAACLRRMDCGRCDFCCDKPKFGGSNQKRQKCRWRQCLQFAMKRLLPSVWSESEDGAGSPPPYRRRKRPSSARRHHLGPTLKPTLATRTAQPDHTQAPTKQEAGGGFVLPPPGTDLVFLREGASSPVQVPGPVAASTEALLQEAQCSGLSWVVALPQVKQEKADTQDEWTPGTAVLTSPVLVPGCPSKAVDPGLPSVKQEPPDPEEDKEENKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRDTAVWLPRSKDLKKPGARKQ 665732782CC6A32A 1433b_human 14-3-3 protein beta/alpha YWHAB Protein kinase C inhibitor protein 1 Protein 1054 protein protein human Homo sapiens Human MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN DIP protein P31946 original sequence version: 171 DIP protein P31946 original sequence version: 97 DIP protein P31946 original sequence version: 119 DIP protein P31946 original sequence version: 122 DIP protein P31946 original sequence version: 180 6BE1A9BF97468017 pal1_caeel Homeobox protein pal-1 pal-1 ceh-3 C38D4.6 Homeobox protein ceh-3 Posterior alae in males protein 1 Caudal homolog 1 protein protein caeel Caenorhabditis elegans MSVDVKSDFSENESSSTPSPTTVPADVTWPHYPMMPFMQPHPLREKMLQPTFDPQIYGRWSQMGDTGFYGHPDLYPFGLPQLAANGQIPAVEAVDVKPPLSNGSSSSDSGMYPSPSDMMTPFPSTSSGAASSSELSAAAAAAANYQMRAATCYQQSVWPFMDYQQFQGFSWKMPLGNNHGKDRRSSSDGKTLPTGPGTNNVRVRTADKYRMVYSDYQRLELEKEFHTSPFITSDRKSQLSTMLSLTERQIKIWFQNRRAKDRRDKQKIRL 8ECBD30E71892A77 eif3i_human Eukaryotic translation initiation factor 3 subunit I EIF3I TRIP1 EIF3S2 Eukaryotic translation initiation factor 3 subunit 2 eIF-3-beta eIF3 p36 TGF-beta receptor-interacting protein 1 protein protein human Homo sapiens Human MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDADWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDKQMGYQCFVSFFDLRDPSQIDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTFRTERPVNSAALSPNYDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEFEA DIP protein Q13347 original sequence version: 86 02797BB72A752A96 hsp90_caeel Heat shock protein 90 daf-21 Abnormal dauer formation protein 21 C47E8.5 protein protein caeel Caenorhabditis elegans MSENAETFAFQAEIAQLMSLIINTFYSNKEIYLRELISNASDALDKIRYQALTEPSELDTGKELFIKITPNKEEKTLTIMDTGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAFLVADKVVVTSKNNDDDSYQWESSAGGSFVVRPFNDPEVTRGTKIVMHIKEDQIDFLEERKIKEIVKKHSQFIGYPIKLVVEKEREKEVEDEEAVEAKDEEKKEGEVENVADDADKKKTKKIKEKYFEDEELNKTKPIWTRNPDDISNEEYAEFYKSLSNDWEDHLAVKHFSVEGQLEFRALLFVPQRAPFDLFENKKSKNSIKLYVRRVFIMENCEELMPEYLNFIKGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKCMELIDEVAEDKDNFKKFYEQFGKNLKLGIHEDSTNRKKLSDFLRYSTSAGDEPTSLKEYVSRMKENQTQIYYITGESKDVVAASAFVERVKSRGFEVLYMCDPIDEYCVQQLKEYDGKKLVSVTKEGLELPETEEEKKKFEEDKVAYENLCKVIKDILEKKVEKVGVSNRLVSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHAIMKTLRDRVEVDKNDKTVKDLVVLLFETALLASGFSLEEPQSHASRIYRMIKLGLDIGDDEIEDSAVPSSCTAEAKIEGAEEDASRMEEVD 2B0E975A24074811 q9xvt3_caeel C15C6.2 CELE_C15C6.2 protein protein caeel Caenorhabditis elegans MSCVQQQRRSTGLRIAERLNKYITLPNRHSFTVDSKDVFQRGQVLSYIRSKAPFLLEHISEAKERLITVTSRGLMIIYENDDHGLVIDLRSARNVLCTADRSKKQRHFRCHIKIRMQRGNVHLFVGHNDVHKWTCAIMRAAGKCLPSTEPRDDGSLNVAMMTAVEDSGIFEEMSSTSSASYDYDEDDEVDEVKPTAIEQIPLPHVSVRSLRQKLEKELVLKPKEQVLAEQQHKANCDEPSFVSEIFCTPRAVFSDETVVLLEPTNARERREYEAQADRENQWWTRSLRC fbli1_human Filamin-binding LIM protein 1 FBLIM1 FBLP1 Migfilin Mitogen-inducible 2-interacting protein protein protein human Homo sapiens Human MASKPEKRVASSVFITLAPPRRDVAVAEEVRQAVCEARRGRPWEAPAPMKTPEAGLAGRPSPWTTPGRAAATVPAAPMQLFNGGCPPPPPVLDGEDVLPDLDLLPPPPPPPPVLLPSEEEAPAPMGASLIADLEQLHLSPPPPPPQAPAEGPSVQPGPLRPMEEELPPPPAEPVEKGASTDICAFCHKTVSPRELAVEAMKRQYHAQCFTCRTCRRQLAGQSFYQKDGRPLCEPCYQDTLERCGKCGEVVRDHIIRALGQAFHPSCFTCVTCARCIGDESFALGSQNEVYCLDDFYRKFAPVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCEDCRILLSVEPTDQGCYPLNNHLFCKPCHVKRSAAGCC 06B8FB911FCCB194 hrg7_caeel Aspartic protease 10 Heme transporter hrg-7 Heme-responsive gene 7 protein asp-10 C15C8.3 hrg-7 protein protein caeel Caenorhabditis elegans MKTFIALLALLTVVSAEVHQFNIGYRPNMRQRMNAKGKLAEYEKERNELLSKKSLQLASSSSPVIDYEDMAYMVQISLGSPAQNFVLFIDSGSSNLWVPDITCAGGKDATCGSYCKSTPYDACLTFCQEECCTKTVEGVKVLSTTDACQSKHRFNSSLSSSYVTNGQKFDMTYNTGEVKGFFGVDTFCFTNTSVCATGQVFGQATTIGEAFAKQPEDGIIGLGWPALAVNQQTPPLFNLMNQGKLDQPYFVVYLANIGPTSQINGGAFTVGGLDTTHCSSNVDWVPLSTQTFWQFKLGGVSSGSYSQAPNSGWQAAADTAASFIGAPKSVVTSLAKAVGATYVPLTGAFFMDCDAVVPDIVFTINGKTYNMPSTSFVVSAGPGPCMFAFYELTAGGFYPAWMLGPPFMRAYCHVHDMKSGRLGLAKVL rs16_caeel 40S ribosomal protein S16 rps-16 T01C3.6 protein protein caeel Caenorhabditis elegans MTSTVQSVQTFGRKKTATAVAHCKKGQGLIKVNGRPLEFLEPQILRIKLQEPLLLVGKERFQDVDIRIRVSGGGHVAQIYAVRQALAKALVAYYHKYVDEQSKRELKNIFAAYDKSLLVADPRRRESKKFGGPGARARYQKSYR 2406E2F8EEBF4A7D 14331_caeel 14-3-3-like protein 1 par-5 ftt-1 M117.2 Partitioning defective protein 5 protein protein caeel Caenorhabditis elegans MSDTVEELVQRAKLAEQAERYDDMAAAMKKVTEQGQELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQQLAKEYRVKVEQELNDICQDVLKLLDEFLIVKAGAAESKVFYLKMKGDYYRYLAEVASEDRAAVVEKSQKAYQEALDIAKDKMQPTHPIRLGLALNFSVFYYEILNTPEHACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDVGAEDQEQEGNQEAGN ABBE0DA27D9341AF le756-pal_1 3 20 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Table 1 le756-daf_21 3 22 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Table 1 le756-rs16 3 26 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Table 1 le756-umps_1 3 8 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Table 1 le756-q18020 3 25 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Table 1 le756-q9xvt3 3 23 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Table 1 le756-q21556 3 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Table 1 le756-q20000 3 7 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Table 1 le756-skr_2 3 16 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Table 1 le756-pal_1-1 1 20 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Table 2A PAL-1 interacted strongly with LET-756 (two positive tests). For the other interactors, only one test was clearly positive (Table 2A). le756-daf_21-1 1 22 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Table 2A PAL-1 interacted strongly with LET-756 (two positive tests). For the other interactors, only one test was clearly positive (Table 2A). le756-rs16-1 1 26 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Table 2A PAL-1 interacted strongly with LET-756 (two positive tests). For the other interactors, only one test was clearly positive (Table 2A). le756-q21556-1 1 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association Table 2A PAL-1 interacted strongly with LET-756 (two positive tests). For the other interactors, only one test was clearly positive (Table 2A). le756-skr_2-1 1 10 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey physical association physical association Table 2A PAL-1 interacted strongly with LET-756 (two positive tests). For the other interactors, only one test was clearly positive (Table 2A). le756-q9xvt3-1 1 23 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Table 2A PAL-1 interacted strongly with LET-756 (two positive tests). For the other interactors, only one test was clearly positive (Table 2A). le756-kin_3 1 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association TABLE 2B le756-kin_10-2 1 15 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association TABLE 2B let56-hsp6 1 10 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association TABLE 2B let56-glg1 1 6 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association TABLE 2B let56-nobp 1 12 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association TABLE 2B let-rpl-6 1 17 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association TABLE 2B let756-par-5 1 27 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association TABLE 2C let756-ftt2 1 10 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association TABLE 2C let756-ywhab 5 19 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association TABLE 3A let756-mbd1 5 10 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association TABLE 3A let756-eif3 5 10 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey physical association physical association TABLE 3A let756-fbpl1 5 24 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association TABLE 3A let-756 4 11 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 1 let756-1 4 10 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 1 let_756-gslg1 4 10 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 2 let756-2 4 10 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 26 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association let756-3 4 22 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 1 let756-5 4 9 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 1 let756-6 4 10 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 1 let756-rpl6 4 17 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 1 let756-c18 4 12 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 1 let756-ftt1 4 27 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 1 let756-ftt2-1 4 10 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 1 let756-ywhab-1 4 19 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 1 let_756-pal_1-1 2 20 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig 2 let_756-rpl_6-1 2 17 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig 2 let_756-par_5 2 27 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig 2 ftt_2-let_756 2 10 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig 2 kin_3-let_756 2 10 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig 2 kin_10-let_756 2 10 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig 2 KIN-10 was present in nucleoplasm of untransfected LET-756 cells and moved with LET-756 into the nuclear speckles when co-transfected. Upon actinomycin D treatment both LET-756 and KIN-10 formed enlarged speckles and moved to the nucleolus. let_756-rps_16-1 2 10 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 26 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig 2 col_129-let_756 2 9 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig 2 gslg1-let_756 2 10 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig 2