UniProt UniProt http://www.uniprot.org Role of Bmi-1 and Ring1A in H2A ubiquitylation and Hox gene silencing. Role of Bmi-1 and Ring1A in H2A ubiquitylation and Hox gene silencing. Mol. Cell (1097-2765) 2005 mimix curation Cao R., Tsukada Y., Zhang Y. fig 1c ubiquitination assay for rnf2 not included; no identity for H2A yi_zhang@med.unc.edu 26-Sep-2011: Contacted by JYOTI. mgt Only protein-protein interactions spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Cao R., Tsukada Y., Zhang Y. fig 1c ubiquitination assay for rnf2 not included; no identity for H2A yi_zhang@med.unc.edu Accepted 2011-JUL-13 by MGT 26-Sep-2011: Contacted by JYOTI. Mol. Cell (1097-2765) 2005 mgt Only protein-protein interactions mimix curation Role of Bmi-1 and Ring1A in H2A ubiquitylation and Hox gene silencing. Role of Bmi-1 and Ring1A in H2A ubiquitylation and Hox gene silencing. Mol. Cell (1097-2765) 2005 mimix curation Cao R., Tsukada Y., Zhang Y. fig 1c ubiquitination assay for rnf2 not included; no identity for H2A yi_zhang@med.unc.edu 26-Sep-2011: Contacted by JYOTI. mgt Only protein-protein interactions spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection anti tag coip anti tag coimmunoprecipitation anti tag coip weight by staining molecular weight estimation by staining weight by staining Cao R., Tsukada Y., Zhang Y. fig 1c ubiquitination assay for rnf2 not included; no identity for H2A yi_zhang@med.unc.edu Accepted 2011-JUL-13 by MGT 26-Sep-2011: Contacted by JYOTI. Mol. Cell (1097-2765) 2005 mgt Only protein-protein interactions mimix curation Role of Bmi-1 and Ring1A in H2A ubiquitylation and Hox gene silencing. Role of Bmi-1 and Ring1A in H2A ubiquitylation and Hox gene silencing. Mol. Cell (1097-2765) 2005 mimix curation Cao R., Tsukada Y., Zhang Y. fig 1c ubiquitination assay for rnf2 not included; no identity for H2A yi_zhang@med.unc.edu 26-Sep-2011: Contacted by JYOTI. mgt Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Cao R., Tsukada Y., Zhang Y. fig 1c ubiquitination assay for rnf2 not included; no identity for H2A yi_zhang@med.unc.edu Accepted 2011-JUL-13 by MGT 26-Sep-2011: Contacted by JYOTI. Mol. Cell (1097-2765) 2005 mgt Only protein-protein interactions mimix curation ring1_mouse E3 ubiquitin-protein ligase RING1 Ring1 Ring1A Rnf1 RING finger protein 1 Polycomb complex protein RING1 Transcription repressor Ring1A RING-type E3 ubiquitin transferase RING1 protein protein mouse Mus musculus Mouse MTTPANAQNASKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPMPGSDQTATMSGGEGEPGEGEGDGEDVSSDSAPDSAPGPAPKRPRGAGAGASSVGTGGGAAGGACGGAGSEDSGDRGGTLGGGTLGPPSPPGAPSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNATVDHLSKYLALRIALERRQQQETTEPGGPGGGASDTGGPDGGGGERGVAGGGEGPEEPALPSLEGVSEKQYTIYIAPGGGAFTTLNGSLTLELVNEKFWKVSRPLELCYAPTKDPK 4F274E976974A2D8 pcgf2_mouse Polycomb group RING finger protein 2 Pcgf2 Mel18 Mel-18 Rnf110 Zfp144 Znf144 DNA-binding protein Mel-18 Melanoma nuclear protein 18 RING finger protein 110 Zinc finger protein 144 protein protein mouse Mus musculus Mouse MHRTTRIKITELNPHLMCALCGGYFIDATTIVECLHSFCKTCIVRYLETNKYCPMCDVQVHKTRPLLSIRSDKTLQDIVYKLVPGLFKDEMKRRRDFYAAYPLTEVPNGSNEDRGEVLEQEKGALGDDEIVSLSIEFYEGVRDREEKKNLTENGDGDKEKTGVRFLRCPAAMTVMHLAKFLRNKMDVPSKYKVEILYEDEPLKEYYTLMDIAYIYPWRRNGPLPLKYRVQPACKRLTLPTVPTPSEGTNTSGASECESVSDKAPSPATLPATSSSLPSPATPSHGSPSSHGPPATHPTSPTPPSTAAGTTTATNGGTSNCLQTPSSTSRGRKMTVNGAPCPP DIP protein P23798 original sequence version: 79 C23031B8B9E30108 ring2_mouse E3 ubiquitin-protein ligase RING2 Rnf2 DinG Ring1b RING finger protein 2 RING finger protein 1B RING-type E3 ubiquitin transferase RING2 protein protein mouse Mus musculus Mouse MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAVAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK DIP protein Q9CQJ4 original sequence version: 124 DIP protein Q9CQJ4 original sequence version: 115 84BA5B3E044DB7EC phc2_mouse Polyhomeotic-like protein 2 p36 Early development regulatory protein 2 Phc2 Edr2 Ph2 protein protein mouse Mus musculus Mouse MENELPVPHTSNRASVTTNTSGTNSSSGCISSSGGGGGSGGRPTAPQISVYSGIPDRQTVQVIQQALHRQPSTAAQYLQQMYAAQQQHLMLQTAALQQQHLSSAQLQSLAAVQQASLVANRQGSTPGSSVSSQAPAQSSSLNLAASPAAAQLINRAQSVNSAAASGLAQQAVLLGNTSSPALTASQAQMYLRAQMLIFTPTATVATVQPELCTGSPARPPTPAQVQNLTLRTQQTPAAAASGPPPTQPVLPSLALKPTPSSSQPLPAPPQGRTMAQGSPAGAKPSGTDNAPETLKAGDGNCNMEGRPGPGRAVPAVATHPLIAPAYAHLQSHQLLPQPPAKHPQPQFVAQQQPQPPRPAPQVQSQPQLASVSPSLALQSSPEDHALPLGSVTQALPLQCSTTHVHKPGNSQQCHLPTLDTGSQNGHPEGGSHPPQRRFQHTSAVILQVQPASPVTPQQCAPDDWKEVVPAEKSVPVARPGPSPHQQAIIPAIPGGLPGPKSPNIQQCPAHETGQGIVHALTDLSSPGMTSGNGNSASSIAGTAPQNGENKPPQAIVKPQILTHVIEGFVIQEGAEPFPVGRSSLLVGNLKKKYAQGFLPEKPPQQDHTTTTDSEMEEPYLQESKEEGTPLKLKCELCGRVDFAYKFKRSKRFCSMACAKRYNVGCTKRVGLFHSDRSKLQKAGTTTHNRRRASKASLPTLTKDTKKQPSGTVPLSVTAALQLAHSQEDSSRCSDNSSYEEPLSPISASSSTSRRRQGQRDLDLPDMHMRDLVGVGHHFLPSEPTKWNVEDVYEFIRSLPGCQEIAEEFRAQEIDGQALLLLKEDHLMSAMNIKLGPALKIYARISMLKDS 87746AFD7808DC7B cbx8_mouse Chromobox protein homolog 8 Cbx8 Pc3 Polycomb 3 homolog protein protein mouse Mus musculus Mouse MELSAVGERVFAAEALLKRRIRKGRMEYLVKWKGWSQKYSTWEPEENILDARLLAAFEEREREMELYGPKKRGPKPKTFLLKAQAKAKAKTYEFRSDSTRGIRIPYPGRSPQDLASTSRAREGLRNTGLPPPGSSTSTCRADPPRDRDRERDRGTSRVDDKPSSPGDSSKKRGPKPRKEPLDPSQRPLGEPSAGLGEYLKGRKLDETSSGTGKFPAGHSVIQLARRQDSDLVQYGVTSPSSAEASSKLAVDTFPARVIKHRAAFLEAKGQGALDPGGARVRHSSGTPASVGSLYRDMGAQGGRPSLIARIPVARILGDPEEESWSPSLTNLEKVVVTDVTSNFLTVTIKESNTDQGFFKEKR EE047F57483741B2 bmi1_mouse Polycomb complex protein BMI-1 Bmi1 Pcgf4 Bmi-1 Polycomb group RING finger protein 4 protein protein mouse Mus musculus Mouse MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEEKRIITDDEIISLSIEFFDQSRLDRKVNKEKPKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKMSHQRDGLTNAGELESDSGSDKANSPAGGVPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSANHQSSFASRPRKSSLNGSSATSSG DIP protein P25916 original sequence version: 81 DIP protein P25916 original sequence version: 133 AD7DECDB6B29DCE5 bmi1-cbx8-4 2 9 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey association association 1b ring1-bmi1-1 3 4 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 2a ring1-cbx8 3 4 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 2a ring1-phc2 3 7 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association 2a rnf2-bmi1 3 9 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 2a rnf2-cbx8 3 6 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 2a rnf2-phc2 3 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 2a bmi1-ring1-1 3 9 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association 2a bmi1-rnf2 3 9 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 2a bmi1-bmi1-3 3 9 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 2a bmi1-cbx8-1 3 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 2a bmi1-phc2 3 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 2a cbx8-ring1-3 3 8 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association 2a cbx8-rnf2-2 3 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 2a cbx8-bmi1-2 3 8 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 2a phc2-ring1 3 7 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association 2a phc2-rnf2 3 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 2a phc2-bmi1 3 7 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 2a bmi1-ring1-2 1 6 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component physical association physical association 6a pcgf2-cbx8-2 2 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey association association 6b ring1-rnf2-3 3 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 2a ring1-ring1 3 4 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association 2a