UniProt UniProt http://www.uniprot.org Chaperoned ubiquitylation--crystal structures of the CHIP U box E3 ubiquitin ligase and a CHIP-Ubc13-Uev1a complex. Chaperoned ubiquitylation--crystal structures of the CHIP U box E3 ubiquitin ligase and a CHIP-Ubc13-Uev1a complex. Mol. Cell (1097-2765) 2005 mimix curation Zhang M., Windheim M., Roe SM., Peggie M., Cohen P., Prodromou C., Pearl LH. laurence.pearl@icr.ac.uk 26-Jun-2011: Contacted by JYOTI. orchard in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Zhang M., Windheim M., Roe SM., Peggie M., Cohen P., Prodromou C., Pearl LH. laurence.pearl@icr.ac.uk Accepted 2011-MAY-09 by ORCHARD 26-Jun-2011: Contacted by JYOTI. Mol. Cell (1097-2765) 2005 orchard mimix curation Chaperoned ubiquitylation--crystal structures of the CHIP U box E3 ubiquitin ligase and a CHIP-Ubc13-Uev1a complex. Chaperoned ubiquitylation--crystal structures of the CHIP U box E3 ubiquitin ligase and a CHIP-Ubc13-Uev1a complex. Mol. Cell (1097-2765) 2005 mimix curation Zhang M., Windheim M., Roe SM., Peggie M., Cohen P., Prodromou C., Pearl LH. laurence.pearl@icr.ac.uk 26-Jun-2011: Contacted by JYOTI. orchard in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Zhang M., Windheim M., Roe SM., Peggie M., Cohen P., Prodromou C., Pearl LH. laurence.pearl@icr.ac.uk Accepted 2011-MAY-09 by ORCHARD 26-Jun-2011: Contacted by JYOTI. Mol. Cell (1097-2765) 2005 orchard mimix curation Chaperoned ubiquitylation--crystal structures of the CHIP U box E3 ubiquitin ligase and a CHIP-Ubc13-Uev1a complex. Chaperoned ubiquitylation--crystal structures of the CHIP U box E3 ubiquitin ligase and a CHIP-Ubc13-Uev1a complex. Mol. Cell (1097-2765) 2005 mimix curation Zhang M., Windheim M., Roe SM., Peggie M., Cohen P., Prodromou C., Pearl LH. laurence.pearl@icr.ac.uk 26-Jun-2011: Contacted by JYOTI. orchard human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Zhang M., Windheim M., Roe SM., Peggie M., Cohen P., Prodromou C., Pearl LH. laurence.pearl@icr.ac.uk Accepted 2011-MAY-09 by ORCHARD 26-Jun-2011: Contacted by JYOTI. Mol. Cell (1097-2765) 2005 orchard mimix curation Chaperoned ubiquitylation--crystal structures of the CHIP U box E3 ubiquitin ligase and a CHIP-Ubc13-Uev1a complex. Chaperoned ubiquitylation--crystal structures of the CHIP U box E3 ubiquitin ligase and a CHIP-Ubc13-Uev1a complex. Mol. Cell (1097-2765) 2005 mimix curation Zhang M., Windheim M., Roe SM., Peggie M., Cohen P., Prodromou C., Pearl LH. laurence.pearl@icr.ac.uk 26-Jun-2011: Contacted by JYOTI. orchard in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zhang M., Windheim M., Roe SM., Peggie M., Cohen P., Prodromou C., Pearl LH. laurence.pearl@icr.ac.uk Accepted 2011-MAY-09 by ORCHARD 26-Jun-2011: Contacted by JYOTI. Mol. Cell (1097-2765) 2005 orchard mimix curation Chaperoned ubiquitylation--crystal structures of the CHIP U box E3 ubiquitin ligase and a CHIP-Ubc13-Uev1a complex. Chaperoned ubiquitylation--crystal structures of the CHIP U box E3 ubiquitin ligase and a CHIP-Ubc13-Uev1a complex. Mol. Cell (1097-2765) 2005 mimix curation Zhang M., Windheim M., Roe SM., Peggie M., Cohen P., Prodromou C., Pearl LH. laurence.pearl@icr.ac.uk 26-Jun-2011: Contacted by JYOTI. orchard in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhang M., Windheim M., Roe SM., Peggie M., Cohen P., Prodromou C., Pearl LH. laurence.pearl@icr.ac.uk Accepted 2011-MAY-09 by ORCHARD 26-Jun-2011: Contacted by JYOTI. Mol. Cell (1097-2765) 2005 orchard mimix curation Chaperoned ubiquitylation--crystal structures of the CHIP U box E3 ubiquitin ligase and a CHIP-Ubc13-Uev1a complex. Chaperoned ubiquitylation--crystal structures of the CHIP U box E3 ubiquitin ligase and a CHIP-Ubc13-Uev1a complex. Mol. Cell (1097-2765) 2005 mimix curation Zhang M., Windheim M., Roe SM., Peggie M., Cohen P., Prodromou C., Pearl LH. laurence.pearl@icr.ac.uk 26-Jun-2011: Contacted by JYOTI. orchard human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down western blot western blot Immuno blot Immuno blot Zhang M., Windheim M., Roe SM., Peggie M., Cohen P., Prodromou C., Pearl LH. laurence.pearl@icr.ac.uk Accepted 2011-MAY-09 by ORCHARD 26-Jun-2011: Contacted by JYOTI. Mol. Cell (1097-2765) 2005 orchard mimix curation ub2v1_human Ubiquitin-conjugating enzyme E2 variant 1 CROC-1 TRAF6-regulated IKK activator 1 beta Uev1A P/OKcl.19 UBE2V1 CROC1 UBE2V UEV1 protein protein human Homo sapiens Human MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN BA53837F21977B3F hs90a_human Heat shock protein HSP 90-alpha HSP90AA1 HSP90A HSPC1 Heat shock 86 kDa Renal carcinoma antigen NY-REN-38 HSPCA Lipopolysaccharide-associated protein 2 protein protein human Homo sapiens Human MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKCLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTSRMEEVD DIP protein P07900 original sequence version: 197 DIP protein P07900 original sequence version: 116 DIP protein P07900 original sequence version: 150 DIP protein P07900-1 original sequence version: 158 DIP protein P07900 original sequence version: 207 DIP protein P07900 original sequence version: 192 DIP protein P07900 original sequence version: 156 969F65FCC0BC86FD chip_mouse E3 ubiquitin-protein ligase CHIP Carboxy terminus of Hsp70-interacting protein Stub1 Chip RING-type E3 ubiquitin transferase CHIP STIP1 homology and U box-containing protein 1 protein protein mouse Mus musculus Mouse MKGKEEKEGGARLGTGGGGSPDKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLTRLIAAERERELEECQRNHEGHEDDGHIRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY DIP protein Q9WUD1 original sequence version: 66 DIP protein Q9WUD1 original sequence version: 96 18BD2728908025A8 chip_human E3 ubiquitin-protein ligase CHIP CHIP STUB1 PP1131 Carboxy terminus of Hsp70-interacting protein STIP1 homology and U box-containing protein 1 CLL-associated antigen KW-8 Antigen NY-CO-7 RING-type E3 ubiquitin transferase CHIP protein protein human Homo sapiens Human MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY 7E7D6568B17070BF ube2n_mouse Ubiquitin-conjugating enzyme E2 N Ubiquitin-protein ligase N Ubiquitin carrier protein N Ubc13 Bendless-like ubiquitin-conjugating enzyme E2 ubiquitin-conjugating enzyme N Ube2n Blu protein protein mouse Mus musculus Mouse MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI FACD84D883D77407 ube2n_human Ubiquitin-conjugating enzyme E2 N Ubiquitin-protein ligase N Ubiquitin carrier protein N Ubc13 Bendless-like ubiquitin-conjugating enzyme UBE2N BLU UbcH13 E2 ubiquitin-conjugating enzyme N protein protein human Homo sapiens Human MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI DIP protein P61088 original sequence version: 137 DIP protein P61088 original sequence version: 105 DIP protein P61088 original sequence version: 60 DIP protein P61088 original sequence version: 64 DIP protein P61088 original sequence version: 85 FACD84D883D77407 hsp90aa1-stub1 4 9 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component direct interaction direct interaction fig 2 ube2n-ube2v1-1 5 10 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association fig 5A ube2n-ube2v1-2 2 7 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait direct interaction direct interaction fig 5B ube2n-stub1 2 10 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait direct interaction direct interaction fig 5B ube2n-stub1-1 3 7 unspecified role unspecified role neutral component neutral component human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 10 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 12 unspecified role unspecified role bait bait physical association physical association fig 5A ube2v1-ube2n-2 2 12 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait direct interaction direct interaction fig 5B ube2v1-stub1 2 12 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait association association fig 5B ube2v1-stub1-1 6 12 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association fig 5C stub1-ube2n-4 4 11 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component physical association physical association fig6 stub1-ube2n-5 1 12 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait direct interaction direct interaction fig 7B hsp90aa1-stub1-2 5 8 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey direct interaction direct interaction fig 7E hsp90aa1-stub1-3 5 8 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey association association fig 7E ube2n-stub1-2 1 12 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey direct interaction direct interaction fig 7C