MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it ERK2 shows a restrictive and locally selective mechanism of recognition by its tyrosine phosphatase inactivators not shared by its activator MEK1. ERK2 shows a restrictive and locally selective mechanism of recognition by its tyrosine phosphatase inactivators not shared by its activator MEK1. J. Biol. Chem. (0021-9258) 2005 Tárrega C., Ríos P., Cejudo-Marín R., Blanco-Aparicio C., van den Berk L., Schepens J., Hendriks W., Tabernero L., Pulido R. partial coverage rapid curation in vitro In vitro phosphatase assay phosphatase assay predetermined predetermined participant predetermined Tárrega C., Ríos P., Cejudo-Marín R., Blanco-Aparicio C., van den Berk L., Schepens J., Hendriks W., Tabernero L., Pulido R. J. Biol. Chem. (0021-9258) 2005 partial coverage rapid curation ERK2 shows a restrictive and locally selective mechanism of recognition by its tyrosine phosphatase inactivators not shared by its activator MEK1. ERK2 shows a restrictive and locally selective mechanism of recognition by its tyrosine phosphatase inactivators not shared by its activator MEK1. J. Biol. Chem. (0021-9258) 2005 Tárrega C., Ríos P., Cejudo-Marín R., Blanco-Aparicio C., van den Berk L., Schepens J., Hendriks W., Tabernero L., Pulido R. partial coverage rapid curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tárrega C., Ríos P., Cejudo-Marín R., Blanco-Aparicio C., van den Berk L., Schepens J., Hendriks W., Tabernero L., Pulido R. J. Biol. Chem. (0021-9258) 2005 partial coverage rapid curation ptprr_mouse Receptor-type tyrosine-protein phosphatase R Ptprr Ptp13 Phosphotyrosine phosphatase 13 Protein-tyrosine-phosphatase SL protein protein mouse Mus musculus Mouse MRRAVGFPALCLLLNLHAAGCFSRNNDHFLAIRQKKSWKPVFIYDHSQDIKKSLDIAQEAYKHNYHSPSEVQISKHHQIINSAFPRPAYDPSLNLLAESDQDLEIENLPIPAANVIVVTLQMDITKLNITLLRIFRQGVAAALGLLPQQVHINRLIEKKNQVELFVSPGNRKPGETQALQAEEVLRSLNVDGLHQSLPQFGITDVAPEKNVLQGQHEADKIWSKEGFYAVVIFLSIFIIIVTCLMIIYRLKERLQLSLRQDKEKNQEIHLSPIARQQAQSEAKTTHSMVQPDQAPKVLNVVVDPQGQCTPEIRNSTSTSVCPSPFRMKPIGLQERRGSNVSLTLDMSSLGSVEPFVAVSTPREKVAMEYLQSASRVLTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRYKTILPNPLSRVCLRPKNITDSLSTYINANYIRGYSGKEKAFIATQGPMINTVNDFWQMVWQEDSPVIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVTGVTECDNYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASEGRGPVVVHCSAGIGRTGCFIATSIGCQQLKEEGVVDALSIVCQLRVDRGGMVQTSEQYEFVHHALCLFESRLSPETVE mint Sequesters mitogen-activated protein kinases (MAPKs) such as MAPK1, MAPK3 and MAPK14 in the cytoplasm in an inactive form. The MAPKs bind to a dephosphorylated kinase interacting motif, phosphorylation of which by the protein kinase A complex releases the MAPKs for activation and translocation into the nucleus. Isoform gamma may have a role in patterning and cellular proliferation of skeletal elements in the precartilaginous/cartilaginous skeleton 31FA82F582992720 dus6_mouse Dual specificity protein phosphatase 6 Dusp6 Mkp3 Mitogen-activated protein kinase phosphatase 3 protein protein mouse Mus musculus Mouse MIDTLRPVPFASEMAICKTVSWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPGIMLRRLQKGNLPVRALFTRCEDRDRFTRRCGTDTVVLYDENSSDWNENTGGESVLGLLLKKLKDEGCRAFYLEGGFSKFQAEFALHCETNLDGSCSSSSPPLPVLGLGGLRISSDSSSDIESDLDRDPNSATDSDGSPLSNSQPSFPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRVPTPQLYFTTPSNQNVYQVDSLQST mint Inactivates MAP kinases. Has a specificity for the ERK family 7EA1FB154F4AD2DA mk01_mouse Mitogen-activated protein kinase 1 Mapk1 Erk2 Mapk Prkm1 Extracellular signal-regulated kinase 2 Mitogen-activated protein kinase 2 MAP kinase isoform p42 ERT1 protein protein mouse Mus musculus Mouse MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS DIP protein P63085 original sequence version: 120 DIP protein P63085 original sequence version: 94 DIP protein P63085 original sequence version: 88 DIP protein P63085 original sequence version: 103 DIP protein P63085 original sequence version: 121 DIP protein P63085 original sequence version: 101 3BBCF22471EDBA0B dusp6-mapk1-1 2 Mkp3 4 unspecified role unspecified role bait bait Erk2 5 unspecified role unspecified role prey prey physical association physical association f4b homomint mint ptprr-mapk1-2 2 PTP-SL 3 unspecified role unspecified role bait bait Erk2 5 unspecified role unspecified role prey prey physical association physical association f4b homomint mint mapk1-ptprr-6 1 PTP-SL 3 enzyme enzyme neutral component neutral component Erk2 5 enzyme target enzyme target substrate substrate neutral component neutral component P63085:p.Glu79Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain E A Tue Jul 12 10:06:41 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:03:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu79ala' Tue Jun 30 19:40:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu79Ala' physical association physical association f5 homomint mint dusp6-mapk1-2 1 Mkp3 4 enzyme enzyme neutral component neutral component Erk2 5 enzyme target enzyme target substrate substrate neutral component neutral component P63085:p.Glu79Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain E A Tue Jul 12 10:06:14 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:42:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu79ala' Tue Jun 30 17:57:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu79Ala' physical association physical association f5 homomint mint