IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Jab1/CSN5, a component of the COP9 signalosome, regulates transforming growth factor beta signaling by binding to Smad7 and promoting its degradation. Jab1/CSN5, a component of the COP9 signalosome, regulates transforming growth factor beta signaling by binding to Smad7 and promoting its degradation. Mol. Cell. Biol. (0270-7306) 2004 imex curation Kim BC., Lee HJ., Park SH., Lee SR., Karpova TS., McNally JG., Felici A., Lee DK., Kim SJ. kims@mail.nih.gov 23-Sept-2011: Contacted by JYOTI. Pre-transformed human placenta cDNA orchard Only protein-protein interactions human-hacat Homo sapiens immortalised keratinocytes hacat human immortalised keratinocytes anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim BC., Lee HJ., Park SH., Lee SR., Karpova TS., McNally JG., Felici A., Lee DK., Kim SJ. kims@mail.nih.gov Accepted 2011-SEP-12 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Pre-transformed human placenta cDNA Mol. Cell. Biol. (0270-7306) 2004 orchard Only protein-protein interactions imex curation Jab1/CSN5, a component of the COP9 signalosome, regulates transforming growth factor beta signaling by binding to Smad7 and promoting its degradation. Jab1/CSN5, a component of the COP9 signalosome, regulates transforming growth factor beta signaling by binding to Smad7 and promoting its degradation. Mol. Cell. Biol. (0270-7306) 2004 imex curation Kim BC., Lee HJ., Park SH., Lee SR., Karpova TS., McNally JG., Felici A., Lee DK., Kim SJ. kims@mail.nih.gov 23-Sept-2011: Contacted by JYOTI. Pre-transformed human placenta cDNA orchard Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down anti tag western anti tag western blot anti tag western Kim BC., Lee HJ., Park SH., Lee SR., Karpova TS., McNally JG., Felici A., Lee DK., Kim SJ. kims@mail.nih.gov Accepted 2011-SEP-12 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Pre-transformed human placenta cDNA Mol. Cell. Biol. (0270-7306) 2004 orchard Only protein-protein interactions imex curation Jab1/CSN5, a component of the COP9 signalosome, regulates transforming growth factor beta signaling by binding to Smad7 and promoting its degradation. Jab1/CSN5, a component of the COP9 signalosome, regulates transforming growth factor beta signaling by binding to Smad7 and promoting its degradation. Mol. Cell. Biol. (0270-7306) 2004 imex curation Kim BC., Lee HJ., Park SH., Lee SR., Karpova TS., McNally JG., Felici A., Lee DK., Kim SJ. kims@mail.nih.gov 23-Sept-2011: Contacted by JYOTI. Pre-transformed human placenta cDNA orchard Only protein-protein interactions human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). pull down pull down anti tag western anti tag western blot anti tag western Kim BC., Lee HJ., Park SH., Lee SR., Karpova TS., McNally JG., Felici A., Lee DK., Kim SJ. Source of SMAD4 inferred from previous work of the author (PMID: 11230153). kims@mail.nih.gov Accepted 2011-SEP-12 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Pre-transformed human placenta cDNA Mol. Cell. Biol. (0270-7306) 2004 orchard Only protein-protein interactions imex curation Jab1/CSN5, a component of the COP9 signalosome, regulates transforming growth factor beta signaling by binding to Smad7 and promoting its degradation. Jab1/CSN5, a component of the COP9 signalosome, regulates transforming growth factor beta signaling by binding to Smad7 and promoting its degradation. Mol. Cell. Biol. (0270-7306) 2004 imex curation Kim BC., Lee HJ., Park SH., Lee SR., Karpova TS., McNally JG., Felici A., Lee DK., Kim SJ. kims@mail.nih.gov 23-Sept-2011: Contacted by JYOTI. Pre-transformed human placenta cDNA orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kim BC., Lee HJ., Park SH., Lee SR., Karpova TS., McNally JG., Felici A., Lee DK., Kim SJ. kims@mail.nih.gov Accepted 2011-SEP-12 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Pre-transformed human placenta cDNA Mol. Cell. Biol. (0270-7306) 2004 orchard Only protein-protein interactions imex curation Jab1/CSN5, a component of the COP9 signalosome, regulates transforming growth factor beta signaling by binding to Smad7 and promoting its degradation. Jab1/CSN5, a component of the COP9 signalosome, regulates transforming growth factor beta signaling by binding to Smad7 and promoting its degradation. Mol. Cell. Biol. (0270-7306) 2004 imex curation Kim BC., Lee HJ., Park SH., Lee SR., Karpova TS., McNally JG., Felici A., Lee DK., Kim SJ. kims@mail.nih.gov 23-Sept-2011: Contacted by JYOTI. Pre-transformed human placenta cDNA orchard Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 confocal microscopy confocal microscopy anti tag immunost anti tag immunostaining anti tag immunost Kim BC., Lee HJ., Park SH., Lee SR., Karpova TS., McNally JG., Felici A., Lee DK., Kim SJ. kims@mail.nih.gov Accepted 2011-SEP-12 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Pre-transformed human placenta cDNA Mol. Cell. Biol. (0270-7306) 2004 orchard Only protein-protein interactions imex curation Jab1/CSN5, a component of the COP9 signalosome, regulates transforming growth factor beta signaling by binding to Smad7 and promoting its degradation. Jab1/CSN5, a component of the COP9 signalosome, regulates transforming growth factor beta signaling by binding to Smad7 and promoting its degradation. Mol. Cell. Biol. (0270-7306) 2004 imex curation Kim BC., Lee HJ., Park SH., Lee SR., Karpova TS., McNally JG., Felici A., Lee DK., Kim SJ. kims@mail.nih.gov 23-Sept-2011: Contacted by JYOTI. Pre-transformed human placenta cDNA orchard Only protein-protein interactions human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kim BC., Lee HJ., Park SH., Lee SR., Karpova TS., McNally JG., Felici A., Lee DK., Kim SJ. kims@mail.nih.gov Accepted 2011-SEP-12 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Pre-transformed human placenta cDNA Mol. Cell. Biol. (0270-7306) 2004 orchard Only protein-protein interactions imex curation Jab1/CSN5, a component of the COP9 signalosome, regulates transforming growth factor beta signaling by binding to Smad7 and promoting its degradation. Jab1/CSN5, a component of the COP9 signalosome, regulates transforming growth factor beta signaling by binding to Smad7 and promoting its degradation. Mol. Cell. Biol. (0270-7306) 2004 imex curation Kim BC., Lee HJ., Park SH., Lee SR., Karpova TS., McNally JG., Felici A., Lee DK., Kim SJ. kims@mail.nih.gov 23-Sept-2011: Contacted by JYOTI. Pre-transformed human placenta cDNA orchard Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Kim BC., Lee HJ., Park SH., Lee SR., Karpova TS., McNally JG., Felici A., Lee DK., Kim SJ. kims@mail.nih.gov Accepted 2011-SEP-12 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Pre-transformed human placenta cDNA Mol. Cell. Biol. (0270-7306) 2004 orchard Only protein-protein interactions imex curation Jab1/CSN5, a component of the COP9 signalosome, regulates transforming growth factor beta signaling by binding to Smad7 and promoting its degradation. Jab1/CSN5, a component of the COP9 signalosome, regulates transforming growth factor beta signaling by binding to Smad7 and promoting its degradation. Mol. Cell. Biol. (0270-7306) 2004 imex curation Kim BC., Lee HJ., Park SH., Lee SR., Karpova TS., McNally JG., Felici A., Lee DK., Kim SJ. kims@mail.nih.gov 23-Sept-2011: Contacted by JYOTI. Pre-transformed human placenta cDNA orchard Only protein-protein interactions human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). confocal microscopy confocal microscopy anti tag immunost anti tag immunostaining anti tag immunost Kim BC., Lee HJ., Park SH., Lee SR., Karpova TS., McNally JG., Felici A., Lee DK., Kim SJ. kims@mail.nih.gov Accepted 2011-SEP-12 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Pre-transformed human placenta cDNA Mol. Cell. Biol. (0270-7306) 2004 orchard Only protein-protein interactions imex curation csn5_human COP9 signalosome complex subunit 5 Jun activation domain-binding protein 1 COPS5 CSN5 JAB1 protein protein human Homo sapiens Human MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS DIP protein Q92905 original sequence version: 161 DIP protein Q92905 original sequence version: 87 DIP protein Q92905 original sequence version: 132 DIP protein Q92905 original sequence version: 149 DIP protein Q92905 original sequence version: 136 DIP protein Q92905 original sequence version: 101 B5742F4AAD03A1CF smad7_human Mothers against decapentaplegic homolog 7 SMAD7 MADH7 MADH8 Mothers against decapentaplegic homolog 8 SMAD family member 7 protein protein human Homo sapiens Human MFRTKRSALVRRLWRSRAPGGEDEEEGAGGGGGGGELRGEGATDSRAHGAGGGGPGRAGCCLGKAVRGAKGHHHPHPPAAGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGGTRTACLLLPGRLDCRLGPGAPAGAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQLNSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKVFPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLEVIFNSR DIP protein O15105 original sequence version: 121 DIP protein O15105 original sequence version: 131 DIP protein O15105 original sequence version: 139 smad4_human Mothers against decapentaplegic homolog 4 SMAD4 DPC4 MADH4 SMAD family member 4 Deletion target in pancreatic carcinoma 4 protein protein human Homo sapiens Human MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQTIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQIASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGHYWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQPLD DIP protein Q13485 original sequence version: 149 DIP protein Q13485 original sequence version: 177 7EE3C4647712DA90 smad7-cops5 4 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association cops5-smad7 3 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1A cops5-smad4-1 3 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1B smad7-cops5-1 1 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Fig. 1F TGF-ß1 plus MG132, an inhibitor of proteosome-mediated degradation. cops5-smad7-3 2 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 2B cops5-smad7-4 2 10 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 2A cops5-smad7-7 5 10 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 3A and 3D cops5-smad7-8 8 10 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 3C cops5-smad7-9 7 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Figure 1D cops5-smad7-10 6 9 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 1C smad7-cops5-2 6 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 1E