IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ PI3 kinase enhancer-Homer complex couples mGluRI to PI3 kinase, preventing neuronal apoptosis. PI3 kinase enhancer-Homer complex couples mGluRI to PI3 kinase, preventing neuronal apoptosis. Nat. Neurosci. (1097-6256) 2003 imex curation Rong R., Ahn J.Y., Huang H., Nagata E., Kalman D., Kapp J.A., Tu J., Worley P.F., Snyder S.H., Ye K. kye@emory.edu 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Rong R., Ahn J.Y., Huang H., Nagata E., Kalman D., Kapp J.A., Tu J., Worley P.F., Snyder S.H., Ye K. kye@emory.edu Accepted 2011-OCT-17 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Nat. Neurosci. (1097-6256) 2003 Only protein-protein interactions imex curation PI3 kinase enhancer-Homer complex couples mGluRI to PI3 kinase, preventing neuronal apoptosis. PI3 kinase enhancer-Homer complex couples mGluRI to PI3 kinase, preventing neuronal apoptosis. Nat. Neurosci. (1097-6256) 2003 imex curation Rong R., Ahn J.Y., Huang H., Nagata E., Kalman D., Kapp J.A., Tu J., Worley P.F., Snyder S.H., Ye K. kye@emory.edu 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions rat-brain-hippocampus Hippocampus of rat brain rat-brain-hippocampus Hippocampus of rat brain confocal microscopy confocal microscopy immunostaining immunostaining Rong R., Ahn J.Y., Huang H., Nagata E., Kalman D., Kapp J.A., Tu J., Worley P.F., Snyder S.H., Ye K. kye@emory.edu Accepted 2011-OCT-17 by ORCHARD Nat. Neurosci. (1097-6256) 2003 Only protein-protein interactions imex curation PI3 kinase enhancer-Homer complex couples mGluRI to PI3 kinase, preventing neuronal apoptosis. PI3 kinase enhancer-Homer complex couples mGluRI to PI3 kinase, preventing neuronal apoptosis. Nat. Neurosci. (1097-6256) 2003 imex curation Rong R., Ahn J.Y., Huang H., Nagata E., Kalman D., Kapp J.A., Tu J., Worley P.F., Snyder S.H., Ye K. kye@emory.edu 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions rat-brain-hippocampus Hippocampus of rat brain rat-brain-hippocampus Hippocampus of rat brain anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rong R., Ahn J.Y., Huang H., Nagata E., Kalman D., Kapp J.A., Tu J., Worley P.F., Snyder S.H., Ye K. kye@emory.edu Accepted 2011-OCT-17 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Nat. Neurosci. (1097-6256) 2003 Only protein-protein interactions imex curation PI3 kinase enhancer-Homer complex couples mGluRI to PI3 kinase, preventing neuronal apoptosis. PI3 kinase enhancer-Homer complex couples mGluRI to PI3 kinase, preventing neuronal apoptosis. Nat. Neurosci. (1097-6256) 2003 imex curation Rong R., Ahn J.Y., Huang H., Nagata E., Kalman D., Kapp J.A., Tu J., Worley P.F., Snyder S.H., Ye K. kye@emory.edu 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions rat-brain Rattus norvegicus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rong R., Ahn J.Y., Huang H., Nagata E., Kalman D., Kapp J.A., Tu J., Worley P.F., Snyder S.H., Ye K. kye@emory.edu Accepted 2011-OCT-17 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Nat. Neurosci. (1097-6256) 2003 Only protein-protein interactions imex curation PI3 kinase enhancer-Homer complex couples mGluRI to PI3 kinase, preventing neuronal apoptosis. PI3 kinase enhancer-Homer complex couples mGluRI to PI3 kinase, preventing neuronal apoptosis. Nat. Neurosci. (1097-6256) 2003 imex curation Rong R., Ahn J.Y., Huang H., Nagata E., Kalman D., Kapp J.A., Tu J., Worley P.F., Snyder S.H., Ye K. kye@emory.edu 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Rong R., Ahn J.Y., Huang H., Nagata E., Kalman D., Kapp J.A., Tu J., Worley P.F., Snyder S.H., Ye K. kye@emory.edu Accepted 2011-OCT-17 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Nat. Neurosci. (1097-6256) 2003 Only protein-protein interactions imex curation home2_rat Homer protein homolog 2 Cupidin VASP/Ena-related gene up-regulated during seizure and LTP 2 Homer2 Vesl2 protein protein rat Rattus norvegicus (Rat) Rat MGEQPIFTTRAHVFQIDPSTKKNWVPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINSTITPNMTFTKTSQKFGQWADSRANTVFGLGFSSEQQLTKFAEKFQEVREAARLARDKSQEKIETSSNHSQESGCETPSSTQASSVNGTDDEKASHASPADTHLKSENDKLKIALTQSAANVKKWEIELQTLRESNARLTTALQESAASVEQWKRQFSICRDENDRLRSKIEELEEQCGEINREKEKNTQLKRRIEELESEVREKEMELKDLRKQSEIIPQLMSECEYVSEKLEAAERDNQNLEDKVRSLKTDIEESKYRQRHLKGELKSFLEVLDGKIDDLHDFRRGLSKLGTDN 205FA6358F9D198E agap2_rat Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 Agap2 Centg1 Centaurin-gamma-1 Phosphatidylinositol 3-kinase enhancer protein protein rat Rattus norvegicus (Rat) Rat MSRGAGALQRRTTTYLISLTLVKLESVPPPPPSPSAAAVGAPGARGSEPRDPGSPRGAEEPGKKRHERLFHRQDALWISTSSAGAGGAEPPALSPAPASPARPVSPAPGRRLSLWAAPPGPPLSGGLSPDSKPGGAPSSSRRPLLSSPSWGGPEPEGRTGGGVPGSSSPHPGTGSRRLKVAPPPPAPKPFKTVTTSGAKAGGGKGAGSRLSWPESEGKPRVKGSKSTAGTGASAVAAGGGGSAAVTTSGGVGAGAGARGKLSPRKGKSKTLDNSDLHPGPSAGSPPLTVPAIPVPATSVTAASTQPLGPAPPITLEPPAPGLKRGREGGRASTRDRKMLKFISGIFTKSTGGPPGPGPLPGPQGLSSSSGSRELLGAELRASPKAVVNSQEWTLSRSIPELRLGVLGDVRSGKSSLIHRFLTGSYQVLEKPESEQYKKEMLVDGQTHLVLIREEAGAPDAKFSGWADAVIFVFSLEDESSFQAVSHLHGQLISLRGEGRGGLALALVGTQDRISASSPRVVGDARARALCTDMKRCSYYETCATYGLNVDRVFQEVAQKVVTLRKQQQLLAACKSLPSSPSHSAASTPVAGQASNGGHTSDYSSSLPSSPNVGHRELRAEAAAVAGLSTPGSLHRAAKRRTSLFANRRGSDSEKRSLDSRGETTGSGRAIPIKQSFLLKRSGNSLNKEWKKKYVTLSSNGFLLYHPSINDYIHSTHGKEMDLLRTTVKVPGKRPPRAISAFGPSASINGLVKDMSTVQMGEGPEASTPMPSPSPSPSSLQLPTDQTSKHLLKPDRNLARALSTDCTPSGDLSPLSREPPPSPMVKKQRRKKLSTPSKTEGSAVQAEAKRKMWKLKSFGSLRNIYKAEENFEFLIVSSTGQTWHFEAASFEERDAWVQAIESQILASLQCCESSKVKLRTDSQSEAVAIQAIRNAKGNSTCVDCGAPNPTWASLNLGALICIECSGIHRNLGTHLSRVRSLDLDDWPRELTLVLTAIGNDTANRVWESDTRGRAKPTRDSSREERESWIRAKYEQLLFLAPLGTTEEPLGRQLWAAVEAQDVAAVLLLLAHARHGPLDTSVEDPQLRSPLHLAAELAHVVITQLLLWYGADVAARDAQGRTALFYARQAGSQLCADILLQHGCPGEGGSTATTPSAATTPSITATPSPRRRSSAASLGRVDTTIALV B9C8E987D2989378 home1_rat Homer protein homolog 1 Homer1 Homer Vesl PSD-Zip45 VASP/Ena-related gene up-regulated during seizure and LTP 1 protein protein rat Rattus norvegicus (Rat) Rat MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDDERTPDVTQNSEPRAEPAQNALPFSHSAGDRTQGLSHASSAISKHWEAELATLKGNNAKLTAALLESTANVKQWKQQLAAYQEEAERLHKRVTELECVSSQANAVHSHKTELSQTVQELEETLKVKEEEIERLKQEIDNARELQEQRDSLTQKLQEVEIRNKDLEGQLSELEQRLEKSQSEQDAFRSNLKTLLEILDGKIFELTELRDNLAKLLECS A6A21CB14207A384 q9z214-1 Homer protein homolog 1 1c Vesl-1L Homer1 Homer Vesl PSD-Zip45 VASP/Ena-related gene up-regulated during seizure and LTP 1 protein protein rat Rattus norvegicus (Rat) Rat MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDDERTPDVTQNSEPRAEPAQNALPFSHSAGDRTQGLSHASSAISKHWEAELATLKGNNAKLTAALLESTANVKQWKQQLAAYQEEAERLHKRVTELECVSSQANAVHSHKTELSQTVQELEETLKVKEEEIERLKQEIDNARELQEQRDSLTQKLQEVEIRNKDLEGQLSELEQRLEKSQSEQDAFRSNLKTLLEILDGKIFELTELRDNLAKLLECS A6A21CB14207A384 grm1_rat Metabotropic glutamate receptor 1 Grm1 Gprc1a Mglur1 protein protein rat Rattus norvegicus (Rat) Rat MVRLLLIFFPMIFLEMSILPRMPDRKVLLAGASSQRSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIRDSLISIRDEKDGLNRCLPDGQTLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLLSAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGHLLENPNFKKVCTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGRKLLDFLIKSSFVGVSGEEVWFDEKGDAPGRYDIMNLQYTEANRYDYVHVGTWHEGVLNIDDYKIQMNKSGMVRSVCSEPCLKGQIKVIRKGEVSCCWICTACKENEFVQDEFTCRACDLGWWPNAELTGCEPIPVRYLEWSDIESIIAIAFSCLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTLVVTLIIMEPPMPILSYPSIKEVYLICNTSNLGVVAPVGYNGLLIMSCTYYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIAKPERNVRSAFTTSDVVRMHVGDGKLPCRSNTFLNIFRRKKPGAGNANSNGKSVSWSEPGGRQAPKGQHVWQRLSVHVKTNETACNQTAVIKPLTKSYQGSGKSLTFSDASTKTLYNVEEEDNTPSAHFSPPSSPSMVVHRRGPPVATTPPLPPHLTAEETPLFLADSVIPKGLPPPLPQQQPQQPPPQQPPQQPKSLMDQLQGVVTNFGSGIPDFHAVLAGPGTPGNSLRSLYPPPPPPQHLQMLPLHLSTFQEESISPPGEDIDDDSERFKLLQEFVYEREGNTEEDELEEEEDLPTASKLTPEDSPALTPPSPFRDSVASGSSVPSSPVSESVLCTPPNVTYASVILRDYKQSSSTL EEE5A04C50694B9F agap2-grm1 2 7 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component association association 2c agap2-homer1 4 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 3d homer2-agap2 4 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 3d homer1-grm1 3 9 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 7a, 7d The antibody used to co-inmunoprecipitate Homer 1c and grm1 could not distingiush between Homer 1c and Homer 2a. The interaction is annotated to Homer 1c because its presence in the complex was confirmed by a specific antibody in western blot. Quisqualate (grm1 agonist) increased the interaction. mPEP (grm1 specific antagonist) disrupted the interaction. grm1-agap2 3 10 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 7b Quisqualate (grm1 agonist) increased the interaction. mPEP (grm1 specific antagonist) disrupted the interaction. homer1-agap2 3 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 7c The antibody used to co-inmunoprecipitate Homer 1c and agap2 could not distingiush between Homer 1c and Homer 2a. The interaction is annotated to Homer 1c because its presence in the complex was confirmed by a specific antibody in western blot. Quisqualate (grm1 agonist) increased the interaction. mPEP (grm1 specific antagonist) disrupted the interaction. homer1-agap2-8 3 9 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey 7 competitor competitor competitor unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association 7d Quisqualate (grm1 agonist) increased the interaction. mPEP (grm1 specific antagonist) disrupted the interaction. homer1-agap2-4 5 7 unspecified role unspecified role prey prey myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q8CGU4:p.Pro187Leu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P L Wed May 02 16:24:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro187leu' Tue Jun 30 18:46:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro187Leu' This mutation disrupted the interaction when the full length version of agap2 was used. When the mutation was tested in a shortened version of agap2 (aas 1 to 384) it only decreased the interaction. 9 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3c, 4d homer1-agap2-7 1 8 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined evh1 domain sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey cell lysate cell lysate binding region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 46 44 physical association physical association 4c