MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Parallel purification of three catalytic subunits of the protein serine/threonine phosphatase 2A family (PP2A(C), PP4(C), and PP6(C)) and analysis of the interaction of PP2A(C) with alpha4 protein. Parallel purification of three catalytic subunits of the protein serine/threonine phosphatase 2A family (PP2A(C), PP4(C), and PP6(C)) and analysis of the interaction of PP2A(C) with alpha4 protein. Protein Expr. Purif. (1046-5928) 2003 Kloeker S., Reed R., McConnell JL., Chang D., Tran K., Westphal RS., Law BK., Colbran RJ., Kamoun M., Campbell KS., Wadzinski BE. suggested by panni partial coverage rapid curation in vitro In vitro pull down pull down predetermined predetermined participant predetermined Kloeker S., Reed R., McConnell JL., Chang D., Tran K., Westphal RS., Law BK., Colbran RJ., Kamoun M., Campbell KS., Wadzinski BE. suggested by panni Protein Expr. Purif. (1046-5928) 2003 partial coverage rapid curation Parallel purification of three catalytic subunits of the protein serine/threonine phosphatase 2A family (PP2A(C), PP4(C), and PP6(C)) and analysis of the interaction of PP2A(C) with alpha4 protein. Parallel purification of three catalytic subunits of the protein serine/threonine phosphatase 2A family (PP2A(C), PP4(C), and PP6(C)) and analysis of the interaction of PP2A(C) with alpha4 protein. Protein Expr. Purif. (1046-5928) 2003 Kloeker S., Reed R., McConnell JL., Chang D., Tran K., Westphal RS., Law BK., Colbran RJ., Kamoun M., Campbell KS., Wadzinski BE. suggested by panni partial coverage rapid curation chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Kloeker S., Reed R., McConnell JL., Chang D., Tran K., Westphal RS., Law BK., Colbran RJ., Kamoun M., Campbell KS., Wadzinski BE. suggested by panni Protein Expr. Purif. (1046-5928) 2003 partial coverage rapid curation Parallel purification of three catalytic subunits of the protein serine/threonine phosphatase 2A family (PP2A(C), PP4(C), and PP6(C)) and analysis of the interaction of PP2A(C) with alpha4 protein. Parallel purification of three catalytic subunits of the protein serine/threonine phosphatase 2A family (PP2A(C), PP4(C), and PP6(C)) and analysis of the interaction of PP2A(C) with alpha4 protein. Protein Expr. Purif. (1046-5928) 2003 Kloeker S., Reed R., McConnell JL., Chang D., Tran K., Westphal RS., Law BK., Colbran RJ., Kamoun M., Campbell KS., Wadzinski BE. suggested by panni partial coverage rapid curation in vitro In vitro competition binding competition binding predetermined predetermined participant predetermined Kloeker S., Reed R., McConnell JL., Chang D., Tran K., Westphal RS., Law BK., Colbran RJ., Kamoun M., Campbell KS., Wadzinski BE. suggested by panni Protein Expr. Purif. (1046-5928) 2003 partial coverage rapid curation igbp1_mouse Immunoglobulin-binding protein 1 Igbp1 Pc52 Protein phosphatase 2/4/6 regulatory subunit CD79a-binding protein 1 Alpha4 phosphoprotein Lymphocyte signal transduction molecule alpha 4 p52 protein protein mouse Mus musculus Mouse MAASEDELLLPRLPELFETSKKLLEDVEVATEPTGSRTIQDKVSKGLELLEKAAGMLSQLDLFSRNEDLEEIASTDLKYLMVPALQGALTMKQVNPSKRLDHLQRAREHFVHFLTQCHCYHVAEFQLPQTKTNSAENNTASSSMAYPNLVAMASQRQAKIERYKQKKEVEHRLSALKSAVESGQADDERVREYHLLHLRRWIAVSLEELESIDQEIKILKEKDSPREETACHSSLPEKPPMKPFILTRNKAQAKVFGTGYPSLATMTVSDWYEQHQKYGVLPDRGIAKPASADFQRAAQQQEDQEQKDEESEEKALHRMREWDDWKDTHPRGYGNRQNMG mint homomint Associated to surface IgM-receptor; may be involved in signal transduction. May be involved in regulation of the catalytic activity of type 2A-related serine/threonine phosphatases 9C6BEF7C2E56BAE4 pp2aa_human Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform PPP2CA Replication protein C protein protein human Homo sapiens Human MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL DIP protein P67775 original sequence version: 112 DIP protein P67775-1 original sequence version: 98 DIP protein P67775 original sequence version: 29 DIP protein P67775 original sequence version: 102 DIP protein P67775 original sequence version: 65 DIP protein P67775 original sequence version: 67 DIP protein P67775-1 original sequence version: 114 DIP protein P67775 original sequence version: 113 DIP protein P67775-1 original sequence version: 122 C602291F78F34555 igbp1-ppp2ca-3 1 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association homomint mint F5B igbp1-ppp2ca-4 2 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association homomint mint F5A F6 igbp1-ppp2ca-5 3 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey direct interaction direct interaction F7 homomint mint